Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 591803..592207 | Replicon | chromosome |
Accession | NZ_CP013310 | ||
Organism | Vibrio cholerae strain E1162 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | ASZ87_RS17790 | Protein ID | WP_001114075.1 |
Coordinates | 591938..592207 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | ASZ87_RS20835 | Protein ID | WP_099607150.1 |
Coordinates | 591803..591907 (+) | Length | 35 a.a. |
Genomic Context
Location: 587304..588221 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 588378..588767 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 588903..589112 (210 bp)
Type: Others
Protein ID: Protein_630
Type: Others
Protein ID: Protein_630
Location: 589231..589668 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 589732..589950 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 590125..590997 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 591147..591746 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 591803..591907 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 591938..592207 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 592201..592722 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 593021..593146 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 593397..593792 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 594684..595199 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 595383..595796 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 593931..594209 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 594206..594490 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ87_RS17745 | 587304..588221 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
ASZ87_RS17755 | 588378..588767 | + | 390 | WP_001081302.1 | hypothetical protein | - |
ASZ87_RS17760 | 588903..589112 | + | 210 | Protein_630 | GNAT family N-acetyltransferase | - |
ASZ87_RS17765 | 589231..589668 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
ASZ87_RS17770 | 589732..589950 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17780 | 590125..590997 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
ASZ87_RS17785 | 591147..591746 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
ASZ87_RS20835 | 591803..591907 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
ASZ87_RS17790 | 591938..592207 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
ASZ87_RS17795 | 592201..592722 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
ASZ87_RS20840 | 593021..593146 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
ASZ87_RS17810 | 593397..593792 | + | 396 | WP_001000867.1 | hypothetical protein | - |
ASZ87_RS17815 | 593931..594209 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ87_RS17820 | 594206..594490 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ87_RS17825 | 594684..595199 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17830 | 595383..595796 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 435534..596659 | 161125 | |
inside | Integron | - | - | 440614..596283 | 155669 | ||
flank | IS/Tn | - | - | 589231..589668 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T58321 WP_001114075.1 NZ_CP013310:591938-592207 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T58321 NZ_CP013310:591938-592207 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT58321 WP_099607150.1 NZ_CP013310:591803-591907 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT58321 NZ_CP013310:591803-591907 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |