Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 916240..916778 | Replicon | chromosome |
Accession | NZ_CP040173 | ||
Organism | Vibrio cholerae strain VC1374 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | FDZ90_RS18830 | Protein ID | WP_000802136.1 |
Coordinates | 916240..916539 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | FDZ90_RS18835 | Protein ID | WP_001107719.1 |
Coordinates | 916536..916778 (-) | Length | 81 a.a. |
Genomic Context
Location: 911986..912114 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 912175..912357 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 912557..913030 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 913027..913137 (111 bp)
Type: Others
Protein ID: WP_071908312.1
Type: Others
Protein ID: WP_071908312.1
Location: 913179..913805 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 913928..914626 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 914630..914746 (117 bp)
Type: Others
Protein ID: WP_071908339.1
Type: Others
Protein ID: WP_071908339.1
Location: 915324..915503 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 915717..916112 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 917007..917585 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 917589..917699 (111 bp)
Type: Others
Protein ID: WP_071908313.1
Type: Others
Protein ID: WP_071908313.1
Location: 918123..918806 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 919020..919286 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 919441..920040 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 920321..921256 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 921222..921362 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 916240..916539 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 916536..916778 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FDZ90_RS18785 | 911986..912114 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
FDZ90_RS18790 | 912175..912357 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
FDZ90_RS18795 | 912557..913030 | + | 474 | WP_001161076.1 | GrpB family protein | - |
FDZ90_RS18800 | 913027..913137 | + | 111 | WP_071908312.1 | DUF3265 domain-containing protein | - |
FDZ90_RS18805 | 913179..913805 | + | 627 | WP_000365424.1 | LysE family translocator | - |
FDZ90_RS18810 | 913928..914626 | + | 699 | WP_001890502.1 | hypothetical protein | - |
FDZ90_RS18815 | 914630..914746 | + | 117 | WP_071908339.1 | DUF3265 domain-containing protein | - |
FDZ90_RS18820 | 915324..915503 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
FDZ90_RS18825 | 915717..916112 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
FDZ90_RS18830 | 916240..916539 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FDZ90_RS18835 | 916536..916778 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
FDZ90_RS18840 | 917007..917585 | + | 579 | WP_000110120.1 | hypothetical protein | - |
FDZ90_RS18845 | 917589..917699 | + | 111 | WP_071908313.1 | DUF3265 domain-containing protein | - |
FDZ90_RS18850 | 918123..918806 | + | 684 | WP_000877436.1 | hypothetical protein | - |
FDZ90_RS18855 | 919020..919286 | + | 267 | WP_000937852.1 | hypothetical protein | - |
FDZ90_RS18860 | 919441..920040 | + | 600 | WP_000429495.1 | hypothetical protein | - |
FDZ90_RS18865 | 920321..921256 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
FDZ90_RS18870 | 921222..921362 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 882589..977840 | 95251 | |
inside | Integron | catB9 | - | 887669..977464 | 89795 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T125040 WP_000802136.1 NZ_CP040173:c916539-916240 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T125040 NZ_CP040173:c916539-916240 [Vibrio cholerae]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT125040 WP_001107719.1 NZ_CP040173:c916778-916536 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT125040 NZ_CP040173:c916778-916536 [Vibrio cholerae]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |