295396

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 439261..439832 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name doc Uniprot ID Q9KMA2
Locus tag OC617_RS16215 Protein ID WP_000351248.1
Coordinates 439431..439832 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag OC617_RS16210 Protein ID WP_001080654.1
Coordinates 439261..439431 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS16155 434456..434570 + 115 Protein_453 acetyltransferase -
OC617_RS16160 (CNRVC190243H_03171) 434579..434800 + 222 WP_032468461.1 DUF1289 domain-containing protein -
OC617_RS16165 434966..435079 + 114 WP_001889158.1 hypothetical protein -
OC617_RS16170 435028..435255 + 228 WP_073426587.1 DUF1289 domain-containing protein -
OC617_RS16175 (CNRVC190243H_03172) 435596..435928 + 333 WP_000843587.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC617_RS16180 (CNRVC190243H_03173) 435915..436229 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
OC617_RS16185 (CNRVC190243H_03174) 436366..436800 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
OC617_RS16190 (CNRVC190243H_03175) 436968..437123 + 156 WP_000751734.1 hypothetical protein -
OC617_RS16195 (CNRVC190243H_03176) 437248..438228 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
OC617_RS16200 (CNRVC190243H_03177) 438296..438602 + 307 Protein_462 CatB-related O-acetyltransferase -
OC617_RS16205 438739..439137 + 399 Protein_463 GNAT family N-acetyltransferase -
OC617_RS16210 439261..439431 + 171 WP_001080654.1 hypothetical protein Antitoxin
OC617_RS16215 (CNRVC190243H_03179) 439431..439832 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OC617_RS16220 439835..439945 + 111 WP_082798255.1 DUF3265 domain-containing protein -
OC617_RS16225 (CNRVC190243H_03180) 440020..440433 + 414 WP_000049417.1 VOC family protein -
OC617_RS16230 (CNRVC190243H_03181) 440647..440898 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OC617_RS16235 (CNRVC190243H_03182) 440888..441175 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
OC617_RS16240 (CNRVC190243H_03183) 441303..441758 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
OC617_RS16245 441815..441937 + 123 Protein_471 acetyltransferase -
OC617_RS16250 442108..442232 + 125 Protein_472 DUF645 family protein -
OC617_RS16255 442349..442417 + 69 Protein_473 acetyltransferase -
OC617_RS16260 (CNRVC190243H_03184) 442434..442931 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
OC617_RS16265 (CNRVC190243H_03185) 442928..443200 - 273 WP_000246253.1 DUF1778 domain-containing protein -
OC617_RS16270 443352..443414 + 63 Protein_476 acetyltransferase -
OC617_RS16275 (CNRVC190243H_03186) 443431..444099 + 669 WP_000043871.1 hypothetical protein -
OC617_RS16280 (CNRVC190243H_03187) 444251..444538 + 288 WP_000426470.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
flank IS/Tn - - 437248..438228 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14608.71 Da        Isoelectric Point: 4.0128

>T295396 WP_000351248.1 NZ_OW443148:439431-439832 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT295396 WP_001080654.1 NZ_OW443148:439261-439431 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PN34

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References