Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 348284..348822 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | IR04_RS01655 | Protein ID | WP_000802136.1 |
Coordinates | 348284..348583 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | IR04_RS01660 | Protein ID | WP_001107719.1 |
Coordinates | 348580..348822 (-) | Length | 81 a.a. |
Genomic Context
Location: 344219..344401 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 344601..345074 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 345089..345181 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 345223..345849 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 345972..346670 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 346680..346790 (111 bp)
Type: Others
Protein ID: WP_079857360.1
Type: Others
Protein ID: WP_079857360.1
Location: 347368..347547 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 347761..348156 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 349051..349629 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 349651..349743 (93 bp)
Type: Others
Protein ID: WP_014164112.1
Type: Others
Protein ID: WP_014164112.1
Location: 350167..350850 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 351064..351330 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 351485..352084 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 352365..353300 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 353266..353406 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 348284..348583 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 348580..348822 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS01620 | 344219..344401 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
IR04_RS01625 | 344601..345074 | + | 474 | WP_001161076.1 | GrpB family protein | - |
IR04_RS19240 | 345089..345181 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
IR04_RS01630 | 345223..345849 | + | 627 | WP_000365424.1 | LysE family translocator | - |
IR04_RS01635 | 345972..346670 | + | 699 | WP_001890502.1 | hypothetical protein | - |
IR04_RS19245 | 346680..346790 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
IR04_RS01645 | 347368..347547 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
IR04_RS01650 | 347761..348156 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
IR04_RS01655 | 348284..348583 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IR04_RS01660 | 348580..348822 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
IR04_RS19055 | 349051..349629 | + | 579 | WP_000110120.1 | hypothetical protein | - |
IR04_RS19255 | 349651..349743 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
IR04_RS01675 | 350167..350850 | + | 684 | WP_000877436.1 | hypothetical protein | - |
IR04_RS01680 | 351064..351330 | + | 267 | WP_000937852.1 | hypothetical protein | - |
IR04_RS01685 | 351485..352084 | + | 600 | WP_000429495.1 | hypothetical protein | - |
IR04_RS01690 | 352365..353300 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
IR04_RS19270 | 353266..353406 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T48150 WP_000802136.1 NZ_CP009041:c348583-348284 [Vibrio cholerae O1 biovar El Tor]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T48150 NZ_CP009041:c348583-348284 [Vibrio cholerae O1 biovar El Tor]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT48150 WP_001107719.1 NZ_CP009041:c348822-348580 [Vibrio cholerae O1 biovar El Tor]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT48150 NZ_CP009041:c348822-348580 [Vibrio cholerae O1 biovar El Tor]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |