Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 361544..362084 | Replicon | chromosome |
Accession | NZ_CP013314 | ||
Organism | Vibrio cholerae strain E9120 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | ASZ79_RS15995 | Protein ID | WP_000277238.1 |
Coordinates | 361544..361813 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | ASZ79_RS16000 | Protein ID | WP_001258569.1 |
Coordinates | 361806..362084 (-) | Length | 93 a.a. |
Genomic Context
Location: 357034..357420 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 357477..357590 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 357539..357820 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 358078..358614 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 358751..359266 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 360575..360700 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 360716..360754 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 360950..361396 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 362370..362648 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 362900..363106 (207 bp)
Type: Others
Protein ID: Protein_347
Type: Others
Protein ID: Protein_347
Location: 363306..363407 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 363397..363783 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 363978..364229 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 364202..364351 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 364443..364685 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 364937..365215 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 365590..365733 (144 bp)
Type: Others
Protein ID: Protein_354
Type: Others
Protein ID: Protein_354
Location: 365787..365825 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 366037..366504 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 356548..356790 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 359416..359913 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 359910..360182 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 361544..361813 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 361806..362084 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ79_RS15940 | 356548..356790 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ79_RS15945 | 357034..357420 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
ASZ79_RS15950 | 357477..357590 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ASZ79_RS15955 | 357539..357820 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ASZ79_RS15965 | 358078..358614 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ASZ79_RS15970 | 358751..359266 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ASZ79_RS15975 | 359416..359913 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ79_RS15980 | 359910..360182 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ79_RS20555 | 360575..360700 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ASZ79_RS20560 | 360716..360754 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ASZ79_RS15990 | 360950..361396 | + | 447 | WP_000006157.1 | hypothetical protein | - |
ASZ79_RS15995 | 361544..361813 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
ASZ79_RS16000 | 361806..362084 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ASZ79_RS16005 | 362370..362648 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
ASZ79_RS20575 | 362900..363106 | + | 207 | Protein_347 | DUF3709 domain-containing protein | - |
ASZ79_RS20580 | 363306..363407 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ79_RS16010 | 363397..363783 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ79_RS16015 | 363978..364229 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ79_RS16020 | 364202..364351 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ79_RS16025 | 364443..364685 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ79_RS16030 | 364937..365215 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
ASZ79_RS20990 | 365590..365733 | + | 144 | Protein_354 | DUF645 family protein | - |
ASZ79_RS20995 | 365787..365825 | + | 39 | WP_082798268.1 | hypothetical protein | - |
ASZ79_RS16045 | 366037..366504 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..468464 | 163764 | |
inside | Integron | - | - | 309780..468088 | 158308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T58355 WP_000277238.1 NZ_CP013314:c361813-361544 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T58355 NZ_CP013314:c361813-361544 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT58355 WP_001258569.1 NZ_CP013314:c362084-361806 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT58355 NZ_CP013314:c362084-361806 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |