Detailed information of TA system TA230648

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /BrnT(toxin)
• Location: 912430..912928
• Replicon: chromosome
• Accession: NZ_CP090400
• Organism: Vibrio cholerae strain PanChol

Toxin (Protein)

• Gene name: -
• Uniprot ID: Q9KMK7
• Locus tag: LZM82_RS17975
• Protein ID: WP_000589156.1
• Coordinates: 912662..912928 (-)
• Length: 89 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: Q9KMK6
• Locus tag: LZM82_RS17970
• Protein ID: WP_000643598.1
• Coordinates: 912430..912675 (-)
• Length: 82 a.a.

Genomic Context

Location: 907511..907897 (387 bp)
Type: Others
Protein ID: WP_000703163.1

Location: 908054..908560 (507 bp)
Type: Others
Protein ID: WP_000393074.1

Location: 909082..909267 (186 bp)
Type: Others
Protein ID: WP_001999468.1

Location: 909334..909693 (360 bp)
Type: Others
Protein ID: WP_001071541.1

Location: 909846..910850 (1005 bp)
Type: Others
Protein ID: WP_000964920.1

Location: 911066..911248 (183 bp)
Type: Others
Protein ID: WP_000923182.1

Location: 911309..911437 (129 bp)
Type: Others
Protein ID: WP_071908338.1

Location: 911427..911543 (117 bp)
Type: Others
Protein ID: WP_086010881.1

Location: 911540..912334 (795 bp)
Type: Others
Protein ID: WP_001911581.1

Location: 912430..912675 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1

Location: 912662..912928 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1

Location: 912995..913123 (129 bp)
Type: Others
Protein ID: WP_088124358.1

Location: 913113..913775 (663 bp)
Type: Others
Protein ID: WP_000960654.1

Location: 913903..914370 (468 bp)
Type: Others
Protein ID: WP_001289288.1

Location: 914542..914673 (132 bp)
Type: Others
Protein ID: WP_001883067.1

Location: 915192..915470 (279 bp)
Type: Others
Protein ID: WP_000280324.1

Location: 915722..915964 (243 bp)
Type: Others
Protein ID: WP_000107461.1

Location: 916056..916205 (150 bp)
Type: Others
Protein ID: WP_071908333.1

Location: 916178..916429 (252 bp)
Type: Others
Protein ID: WP_001890111.1

Location: 916624..917010 (387 bp)
Type: Others
Protein ID: WP_000703163.1

Location: 917000..917101 (102 bp)
Type: Others
Protein ID: WP_001921603.1

Location: 917301..917399 (99 bp)
Type: Others
Protein ID: WP_223225486.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LZM82_RS17925 (LZM82_17925)	907511..907897	-	387	WP_000703163.1	VOC family protein	-
LZM82_RS17930 (LZM82_17930)	908054..908560	-	507	WP_000393074.1	hypothetical protein	-
LZM82_RS17935 (LZM82_17935)	909082..909267	-	186	WP_001999468.1	hypothetical protein	-
LZM82_RS17940 (LZM82_17940)	909334..909693	-	360	WP_001071541.1	VOC family protein	-
LZM82_RS17945 (LZM82_17945)	909846..910850	-	1005	WP_000964920.1	LD-carboxypeptidase	-
LZM82_RS17950 (LZM82_17950)	911066..911248	-	183	WP_000923182.1	DUF645 family protein	-
LZM82_RS17955 (LZM82_17955)	911309..911437	-	129	WP_071908338.1	general secretion pathway protein GspI	-
LZM82_RS17960 (LZM82_17960)	911427..911543	-	117	WP_086010881.1	DUF3265 domain-containing protein	-
LZM82_RS17965 (LZM82_17965)	911540..912334	-	795	WP_001911581.1	hypothetical protein	-
LZM82_RS17970 (LZM82_17970)	912430..912675	-	246	WP_000643598.1	hypothetical protein	Antitoxin
LZM82_RS17975 (LZM82_17975)	912662..912928	-	267	WP_000589156.1	BrnT family toxin	Toxin
LZM82_RS17980 (LZM82_17980)	912995..913123	-	129	WP_088124358.1	DUF3265 domain-containing protein	-
LZM82_RS17985 (LZM82_17985)	913113..913775	-	663	WP_000960654.1	hypothetical protein	-
LZM82_RS17990 (LZM82_17990)	913903..914370	-	468	WP_001289288.1	OsmC family protein	-
LZM82_RS17995 (LZM82_17995)	914542..914673	-	132	WP_001883067.1	hypothetical protein	-
LZM82_RS18000 (LZM82_18000)	915192..915470	-	279	WP_000280324.1	DUF3709 domain-containing protein	-
LZM82_RS18005 (LZM82_18005)	915722..915964	-	243	WP_000107461.1	hypothetical protein	-
LZM82_RS18010 (LZM82_18010)	916056..916205	-	150	WP_071908333.1	DUF3265 domain-containing protein	-
LZM82_RS18015 (LZM82_18015)	916178..916429	-	252	WP_001890111.1	TIGR03643 family protein	-
LZM82_RS18020 (LZM82_18020)	916624..917010	-	387	WP_000703163.1	VOC family protein	-
LZM82_RS18025 (LZM82_18025)	917000..917101	-	102	WP_001921603.1	hypothetical protein	-
LZM82_RS18030 (LZM82_18030)	917301..917399	-	99	WP_223225486.1	DUF3709 domain-containing protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	835643..943910	108267
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0.004	inside	Integron	-	-	836019..937068	101049

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (6-81)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 89 a.a.
• Molecular weight: 10092.34 Da
• Isoelectric Point: 7.3171

>T230648 WP_000589156.1 NZ_CP090400:c912928-912662 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Nucleotide

• Length: 267 bp

>T230648 NZ_CP125226:5666-5953 [Acinetobacter baumannii]
ATGGAACAGTATTTTGAATGGGATGAGGCTAAGAATCGAAAGAATCAGAAAAAGCATGATATCTCTTTCGAAACTGCAAG
CCTTGTTTTTGAAGATCCATTACGGATCTCAATCCAAGACAGATATACTAATGGTGAAGAACGTTGGCAAACCATTGGAC
GAGTTAAAGGCGTACTAATGTTATTGGTGGCTCACACCATTTTTGATGAAGATGACTGTGAAATCATCCGAATCATTAGT
GCAAGGCAAGTCACTAAAGCGGAGCGAAACAAATATGAGCATGGTTAG

Antitoxin

Protein

• Length: 82 a.a.
• Molecular weight: 9478.77 Da
• Isoelectric Point: 6.4832

>AT230648 WP_000643598.1 NZ_CP090400:c912675-912430 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Nucleotide

• Length: 246 bp

>AT230648 NZ_CP125226:5940-6254 [Acinetobacter baumannii]
ATGAGCATGGTTAGATACTCACACAAAGAGCTGAATGAGAAATTTGGTGAGAAGCAAGATGCTGAAATTCAACGCTTGCT
TGCTAAAGGCACGGTTCCTGATGATCAGCTAGATCTATCAGATATTCCTGAAATTACAGACTGGAGCAATGCTGTACGCC
AAAATCAATTTTACCGCCCAGTAAAGCAACAAACTTCAATTCGGTTAGATGCTGATGTACTTGCTTGGTTCAAAGCACAA
GGCAAAGGTTATCAAACACGTATGAATGAAATTTTACGAGATGCTATGCTAAAAGAATTAAAAAATCATCAATAA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A271VMP7

Antitoxin

Loading, please wait

• AlphaFold DB: A0A271VME2