Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1000116..1000675 | Replicon | chromosome |
Accession | NZ_CP080466 | ||
Organism | Vibrio cholerae strain ICDC-VC3741 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9K2M8 |
Locus tag | K1T75_RS18350 | Protein ID | WP_000578476.1 |
Coordinates | 1000397..1000675 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | K1T75_RS18345 | Protein ID | WP_000381183.1 |
Coordinates | 1000116..1000400 (+) | Length | 95 a.a. |
Genomic Context
Location: 1000116..1000400 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1
Type: Antitoxin
Protein ID: WP_000381183.1
Location: 1000397..1000675 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1
Type: Toxin
Protein ID: WP_000578476.1
Location: 995782..995871 (90 bp)
Type: Others
Protein ID: WP_072606010.1
Type: Others
Protein ID: WP_072606010.1
Location: 995902..996600 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 996723..997349 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 997391..997483 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 997498..997971 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 998171..998353 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 998414..998551 (138 bp)
Type: Others
Protein ID: WP_001890145.1
Type: Others
Protein ID: WP_001890145.1
Location: 998745..999341 (597 bp)
Type: Others
Protein ID: WP_000255434.1
Type: Others
Protein ID: WP_000255434.1
Location: 999406..999867 (462 bp)
Type: Others
Protein ID: WP_001911578.1
Type: Others
Protein ID: WP_001911578.1
Location: 1000826..1001239 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 1001314..1001430 (117 bp)
Type: Others
Protein ID: WP_086010882.1
Type: Others
Protein ID: WP_086010882.1
Location: 1001427..1001906 (480 bp)
Type: Others
Protein ID: WP_000009888.1
Type: Others
Protein ID: WP_000009888.1
Location: 1002119..1002742 (624 bp)
Type: Others
Protein ID: WP_000247070.1
Type: Others
Protein ID: WP_000247070.1
Location: 1002948..1003373 (426 bp)
Type: Others
Protein ID: WP_000415750.1
Type: Others
Protein ID: WP_000415750.1
Location: 1003520..1003669 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 1003642..1003893 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 1004088..1004291 (204 bp)
Type: Others
Protein ID: WP_001911580.1
Type: Others
Protein ID: WP_001911580.1
Location: 1004548..1004934 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 1005091..1005597 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K1T75_RS18305 | 995782..995871 | - | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
K1T75_RS18310 | 995902..996600 | - | 699 | WP_001890502.1 | hypothetical protein | - |
K1T75_RS18315 | 996723..997349 | - | 627 | WP_000365424.1 | LysE family translocator | - |
K1T75_RS18320 | 997391..997483 | - | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
K1T75_RS18325 | 997498..997971 | - | 474 | WP_001161076.1 | GrpB family protein | - |
K1T75_RS18330 | 998171..998353 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
K1T75_RS18950 | 998414..998551 | - | 138 | WP_001890145.1 | hypothetical protein | - |
K1T75_RS18335 | 998745..999341 | - | 597 | WP_000255434.1 | hypothetical protein | - |
K1T75_RS18340 | 999406..999867 | - | 462 | WP_001911578.1 | lipocalin family protein | - |
K1T75_RS18345 | 1000116..1000400 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
K1T75_RS18350 | 1000397..1000675 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
K1T75_RS18355 | 1000826..1001239 | - | 414 | WP_000049420.1 | VOC family protein | - |
K1T75_RS18955 | 1001314..1001430 | - | 117 | WP_086010882.1 | DUF3265 domain-containing protein | - |
K1T75_RS18360 | 1001427..1001906 | - | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
K1T75_RS18365 | 1002119..1002742 | - | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
K1T75_RS18370 | 1002948..1003373 | - | 426 | WP_000415750.1 | hypothetical protein | - |
K1T75_RS18960 | 1003520..1003669 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
K1T75_RS18375 | 1003642..1003893 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
K1T75_RS18380 | 1004088..1004291 | - | 204 | WP_001911580.1 | hypothetical protein | - |
K1T75_RS18385 | 1004548..1004934 | - | 387 | WP_000703163.1 | VOC family protein | - |
K1T75_RS18390 | 1005091..1005597 | - | 507 | WP_000393074.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 932680..1039634 | 106954 | |
inside | Integron | - | - | 933056..1032792 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T211918 WP_000578476.1 NZ_CP080466:1000397-1000675 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
>T211918 NZ_CP106849:c1110016-1109813 [Edwardsiella ictaluri]
ATGACAAAAATCGATTATCTGATGAAGTTGCGTAAATGCACGACGCTGGATACTCTGGAACGCGTGATCGAAAAGAACAA
ATACGAACTTTCAGATGATGAGCTGGAAATTTTTTATTCTGCCGCAGATCATCGACTGGCTGAATTAACCATGAATAAAC
TATACGACAAAATTCCGGCAGAAGTTTGGCAATACGTCCGCTAA
ATGACAAAAATCGATTATCTGATGAAGTTGCGTAAATGCACGACGCTGGATACTCTGGAACGCGTGATCGAAAAGAACAA
ATACGAACTTTCAGATGATGAGCTGGAAATTTTTTATTCTGCCGCAGATCATCGACTGGCTGAATTAACCATGAATAAAC
TATACGACAAAATTCCGGCAGAAGTTTGGCAATACGTCCGCTAA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT211918 WP_000381183.1 NZ_CP080466:1000116-1000400 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT211918 NZ_CP106849:c1110405-1110037 [Edwardsiella ictaluri]
ATGGATGAGAACACTTCTTATCAGCATGACATCTCAGAGTTAAAATACCTGTGTGATTACCTGTATCATCAGGGAATAGA
TGTCTTGGGAGAAAGCAATCACGGCTGGGTCAGCGATCCGACGGCAGAAGTAAATCTACAGCTTAACGAGCTGATTGAGC
ATATTGCCAGCATCGCGCAATCATTTAAGATCAAATATCCGCGTCATTCGGATTTAGCCGAAATGCTGGATTATTATCTG
GATGAAACCTATGCCCTGTTTGGCACCTATAGCATAAGTGAAACGGCGCTCAGGCAATGGTTGCGTACCAAACGTCGGAT
GGCATACTGTCTGGCGCATGAAAAGCGCAACGCTGCCTTACATGTTTAG
ATGGATGAGAACACTTCTTATCAGCATGACATCTCAGAGTTAAAATACCTGTGTGATTACCTGTATCATCAGGGAATAGA
TGTCTTGGGAGAAAGCAATCACGGCTGGGTCAGCGATCCGACGGCAGAAGTAAATCTACAGCTTAACGAGCTGATTGAGC
ATATTGCCAGCATCGCGCAATCATTTAAGATCAAATATCCGCGTCATTCGGATTTAGCCGAAATGCTGGATTATTATCTG
GATGAAACCTATGCCCTGTTTGGCACCTATAGCATAAGTGAAACGGCGCTCAGGCAATGGTTGCGTACCAAACGTCGGAT
GGCATACTGTCTGGCGCATGAAAAGCGCAACGCTGCCTTACATGTTTAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9K2M8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067BL33 |