Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 332927..333465 | Replicon | chromosome |
Accession | NZ_CP013306 | ||
Organism | Vibrio cholerae strain CRC1106 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | ASZ81_RS15815 | Protein ID | WP_000802136.1 |
Coordinates | 332927..333226 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | ASZ81_RS15820 | Protein ID | WP_001107719.1 |
Coordinates | 333223..333465 (-) | Length | 81 a.a. |
Genomic Context
Location: 328132..328314 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 328529..329068 (540 bp)
Type: Others
Protein ID: WP_000099372.1
Type: Others
Protein ID: WP_000099372.1
Location: 329191..329706 (516 bp)
Type: Others
Protein ID: WP_000090011.1
Type: Others
Protein ID: WP_000090011.1
Location: 329841..330377 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 330846..330956 (111 bp)
Type: Others
Protein ID: WP_071908335.1
Type: Others
Protein ID: WP_071908335.1
Location: 331169..331321 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 331605..332048 (444 bp)
Type: Others
Protein ID: WP_000803902.1
Type: Others
Protein ID: WP_000803902.1
Location: 332052..332162 (111 bp)
Type: Others
Protein ID: WP_071908336.1
Type: Others
Protein ID: WP_071908336.1
Location: 333884..333961 (78 bp)
Type: Others
Protein ID: WP_071908337.1
Type: Others
Protein ID: WP_071908337.1
Location: 333965..333991 (27 bp)
Type: Others
Protein ID: Protein_298
Type: Others
Protein ID: Protein_298
Location: 334577..334720 (144 bp)
Type: Others
Protein ID: WP_001900215.1
Type: Others
Protein ID: WP_001900215.1
Location: 334814..334993 (180 bp)
Type: Others
Protein ID: Protein_300
Type: Others
Protein ID: Protein_300
Location: 335211..335639 (429 bp)
Type: Others
Protein ID: WP_000620002.1
Type: Others
Protein ID: WP_000620002.1
Location: 336227..336709 (483 bp)
Type: Others
Protein ID: WP_000422940.1
Type: Others
Protein ID: WP_000422940.1
Location: 337517..337786 (270 bp)
Type: Others
Protein ID: WP_001114075.1
Type: Others
Protein ID: WP_001114075.1
Location: 337780..338301 (522 bp)
Type: Others
Protein ID: WP_000921692.1
Type: Others
Protein ID: WP_000921692.1
Location: 332192..332470 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 332467..332751 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 332927..333226 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 333223..333465 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ81_RS15755 | 328132..328314 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
ASZ81_RS15760 | 328529..329068 | + | 540 | WP_000099372.1 | hypothetical protein | - |
ASZ81_RS15765 | 329191..329706 | + | 516 | WP_000090011.1 | hypothetical protein | - |
ASZ81_RS15770 | 329841..330377 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ81_RS15775 | 330846..330956 | + | 111 | WP_071908335.1 | DUF3265 domain-containing protein | - |
ASZ81_RS15785 | 331169..331321 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ81_RS15790 | 331605..332048 | + | 444 | WP_000803902.1 | hypothetical protein | - |
ASZ81_RS15795 | 332052..332162 | + | 111 | WP_071908336.1 | DUF3265 domain-containing protein | - |
ASZ81_RS15800 | 332192..332470 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ81_RS15805 | 332467..332751 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ81_RS15815 | 332927..333226 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ81_RS15820 | 333223..333465 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
ASZ81_RS15830 | 333884..333961 | + | 78 | WP_071908337.1 | DUF645 family protein | - |
ASZ81_RS20835 | 333965..333991 | + | 27 | Protein_298 | hypothetical protein | - |
ASZ81_RS20915 | 334577..334720 | + | 144 | WP_001900215.1 | hypothetical protein | - |
ASZ81_RS20415 | 334814..334993 | + | 180 | Protein_300 | DUF645 family protein | - |
ASZ81_RS15855 | 335211..335639 | + | 429 | WP_000620002.1 | N-acetyltransferase | - |
ASZ81_RS15865 | 336227..336709 | + | 483 | WP_000422940.1 | GNAT family N-acetyltransferase | - |
ASZ81_RS15875 | 337517..337786 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | - |
ASZ81_RS15880 | 337780..338301 | + | 522 | WP_000921692.1 | DUF2442 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304741..463550 | 158809 | |
inside | Integron | - | - | 309821..463174 | 153353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T58260 WP_000802136.1 NZ_CP013306:c333226-332927 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T58260 NZ_CP013306:c333226-332927 [Vibrio cholerae]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCCGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCCGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT58260 WP_001107719.1 NZ_CP013306:c333465-333223 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT58260 NZ_CP013306:c333465-333223 [Vibrio cholerae]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |