Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
Location | 418494..419587 | Replicon | chromosome |
Accession | NZ_CP047296 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | GTF72_RS16025 | Protein ID | WP_000351248.1 |
Coordinates | 419186..419587 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | GTF72_RS16020 | Protein ID | WP_001047169.1 |
Coordinates | 418494..419186 (+) | Length | 231 a.a. |
Genomic Context
Location: 413777..414154 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 414334..414555 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 414721..414834 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 414783..415010 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 415351..415683 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 415670..415984 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 416121..416555 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416723..416878 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 418051..418323 (273 bp)
Type: Others
Protein ID: Protein_451
Type: Others
Protein ID: Protein_451
Location: 418494..419186 (693 bp)
Type: Antitoxin
Protein ID: WP_001047169.1
Type: Antitoxin
Protein ID: WP_001047169.1
Location: 419186..419587 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 419557..419700 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419775..420188 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 420402..420653 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420643..420930 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 421058..421513 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421835..421987 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 423186..423854 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 424006..424293 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 414531..414689 (159 bp)
Type: Others
Protein ID: WP_001894455.1
Type: Others
Protein ID: WP_001894455.1
Location: 415040..415198 (159 bp)
Type: Others
Protein ID: WP_001882309.1
Type: Others
Protein ID: WP_001882309.1
Location: 417003..417983 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 422189..422686 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 422683..422955 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF72_RS15960 | 413777..414154 | + | 378 | WP_000411109.1 | hypothetical protein | - |
GTF72_RS15965 | 414334..414555 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
GTF72_RS15970 | 414531..414689 | - | 159 | WP_001894455.1 | DUF1196 family protein | - |
GTF72_RS15975 | 414721..414834 | + | 114 | WP_001889158.1 | hypothetical protein | - |
GTF72_RS15980 | 414783..415010 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GTF72_RS15985 | 415040..415198 | - | 159 | WP_001882309.1 | DUF1196 family protein | - |
GTF72_RS15990 | 415351..415683 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTF72_RS15995 | 415670..415984 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
GTF72_RS16000 | 416121..416555 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16005 | 416723..416878 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GTF72_RS16010 | 417003..417983 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GTF72_RS16015 | 418051..418323 | + | 273 | Protein_451 | CatB-related O-acetyltransferase | - |
GTF72_RS16020 | 418494..419186 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
GTF72_RS16025 | 419186..419587 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
GTF72_RS16030 | 419557..419700 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GTF72_RS16035 | 419775..420188 | + | 414 | WP_000049417.1 | VOC family protein | - |
GTF72_RS16040 | 420402..420653 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF72_RS16045 | 420643..420930 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTF72_RS16050 | 421058..421513 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16055 | 421835..421987 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
GTF72_RS16060 | 422189..422686 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16065 | 422683..422955 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GTF72_RS16070 | 423186..423854 | + | 669 | WP_000043871.1 | hypothetical protein | - |
GTF72_RS16075 | 424006..424293 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 417003..417983 | 980 | ||
- | inside | Genomic island | catB9 | - | 306905..436165 | 129260 | |
inside | Integron | - | - | 311985..435789 | 123804 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T145814 WP_000351248.1 NZ_CP047296:419186-419587 [Vibrio cholerae C6706]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T145814 NZ_CP062700:c2928933-2928778 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT145814 WP_001047169.1 NZ_CP047296:418494-419186 [Vibrio cholerae C6706]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
>AT145814 NZ_CP062700:2928945-2929003 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |