Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 126098..126645 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | C4E16_RS15240 | Protein ID | WP_000229317.1 |
Coordinates | 126343..126645 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | C4E16_RS15235 | Protein ID | WP_000861987.1 |
Coordinates | 126098..126355 (+) | Length | 86 a.a. |
Genomic Context
Location: 121127..121582 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 121904..122056 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 123255..123923 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 124075..124362 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 124503..124874 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 124941..125366 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 125363..125896 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 126098..126355 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 126343..126645 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 126879..127796 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 127953..128342 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 128478..128687 (210 bp)
Type: Others
Protein ID: Protein_202
Type: Others
Protein ID: Protein_202
Location: 128806..129243 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 129307..129525 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 129700..130572 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 130722..131321 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 131378..131482 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 122258..122755 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 122752..123024 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS15180 | 121127..121582 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15185 | 121904..122056 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
C4E16_RS15195 | 122258..122755 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15200 | 122752..123024 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
C4E16_RS15205 | 123255..123923 | + | 669 | WP_000043871.1 | hypothetical protein | - |
C4E16_RS15210 | 124075..124362 | + | 288 | WP_000426470.1 | hypothetical protein | - |
C4E16_RS15215 | 124503..124874 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
C4E16_RS19585 | 124941..125366 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
C4E16_RS15225 | 125363..125896 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15235 | 126098..126355 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C4E16_RS15240 | 126343..126645 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C4E16_RS15250 | 126879..127796 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
C4E16_RS15255 | 127953..128342 | + | 390 | WP_001081302.1 | hypothetical protein | - |
C4E16_RS15260 | 128478..128687 | + | 210 | Protein_202 | GNAT family N-acetyltransferase | - |
C4E16_RS15265 | 128806..129243 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
C4E16_RS15270 | 129307..129525 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15275 | 129700..130572 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
C4E16_RS15280 | 130722..131321 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
C4E16_RS15285 | 131378..131482 | + | 105 | WP_099607150.1 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 | ||
flank | IS/Tn | - | - | 128806..129243 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T95389 WP_000229317.1 NZ_CP026648:126343-126645 [Vibrio cholerae O1 biovar El Tor]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T95389 NZ_CP026648:126343-126645 [Vibrio cholerae O1 biovar El Tor]
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT95389 WP_000861987.1 NZ_CP026648:126098-126355 [Vibrio cholerae O1 biovar El Tor]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT95389 NZ_CP026648:126098-126355 [Vibrio cholerae O1 biovar El Tor]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |