294411

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 247143..247721 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag DG169_RS15770 Protein ID WP_001180243.1
Coordinates 247143..247460 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag DG169_RS15775 Protein ID WP_000557292.1
Coordinates 247479..247721 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS15720 242334..242729 + 396 WP_000046952.1 hypothetical protein -
DG169_RS15725 243032..243213 + 182 Protein_248 DUF645 family protein -
DG169_RS15730 243390..243785 + 396 WP_000046953.1 hypothetical protein -
DG169_RS15735 243929..244465 + 537 WP_000644491.1 nucleotidyltransferase family protein -
DG169_RS15740 244762..244941 + 180 WP_001883039.1 DUF645 family protein -
DG169_RS15745 245137..245562 + 426 WP_000403014.1 GNAT family N-acetyltransferase -
DG169_RS15750 245711..246058 + 348 WP_000933409.1 hypothetical protein -
DG169_RS19680 246205..246498 + 294 WP_125460920.1 hypothetical protein -
DG169_RS19830 246854..246949 + 96 WP_001907607.1 DUF645 family protein -
DG169_RS15770 247143..247460 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG169_RS15775 247479..247721 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG169_RS15780 247963..248472 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
DG169_RS15785 248529..249182 + 654 WP_000226874.1 hypothetical protein -
DG169_RS15790 249492..249710 + 219 WP_001917086.1 DUF3709 domain-containing protein -
DG169_RS15795 250113..250346 + 234 WP_032482776.1 DUF3709 domain-containing protein -
DG169_RS15800 250771..250951 + 181 Protein_262 DUF645 family protein -
DG169_RS15810 251218..251505 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG169_RS15815 251516..251833 + 318 WP_001232701.1 HigA family addiction module antidote protein -
DG169_RS19835 251830..251940 + 111 WP_134814058.1 DUF3265 domain-containing protein -
DG169_RS19840 252117..252242 + 126 WP_001944767.1 DUF645 family protein -
DG169_RS19845 252258..252296 + 39 WP_106019119.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T294411 WP_001180243.1 NZ_LT992493:c247460-247143 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT294411 WP_000557292.1 NZ_LT992493:c247721-247479 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References