Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 247143..247721 | Replicon | chromosome |
| Accession | NZ_LT992493 | ||
| Organism | Vibrio cholerae strain 4295STDY6534248 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | O68848 |
| Locus tag | DG169_RS15770 | Protein ID | WP_001180243.1 |
| Coordinates | 247143..247460 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q7DCR7 |
| Locus tag | DG169_RS15775 | Protein ID | WP_000557292.1 |
| Coordinates | 247479..247721 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG169_RS15720 | 242334..242729 | + | 396 | WP_000046952.1 | hypothetical protein | - |
| DG169_RS15725 | 243032..243213 | + | 182 | Protein_248 | DUF645 family protein | - |
| DG169_RS15730 | 243390..243785 | + | 396 | WP_000046953.1 | hypothetical protein | - |
| DG169_RS15735 | 243929..244465 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
| DG169_RS15740 | 244762..244941 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
| DG169_RS15745 | 245137..245562 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
| DG169_RS15750 | 245711..246058 | + | 348 | WP_000933409.1 | hypothetical protein | - |
| DG169_RS19680 | 246205..246498 | + | 294 | WP_125460920.1 | hypothetical protein | - |
| DG169_RS19830 | 246854..246949 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
| DG169_RS15770 | 247143..247460 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG169_RS15775 | 247479..247721 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DG169_RS15780 | 247963..248472 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
| DG169_RS15785 | 248529..249182 | + | 654 | WP_000226874.1 | hypothetical protein | - |
| DG169_RS15790 | 249492..249710 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
| DG169_RS15795 | 250113..250346 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
| DG169_RS15800 | 250771..250951 | + | 181 | Protein_262 | DUF645 family protein | - |
| DG169_RS15810 | 251218..251505 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG169_RS15815 | 251516..251833 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
| DG169_RS19835 | 251830..251940 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
| DG169_RS19840 | 252117..252242 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
| DG169_RS19845 | 252258..252296 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 197768..293032 | 95264 | |
| inside | Integron | catB9 | - | 202848..292656 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T294411 WP_001180243.1 NZ_LT992493:c247460-247143 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9UJR8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7DCR7 |