Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 575845..576478 | Replicon | chromosome |
Accession | NZ_CP013310 | ||
Organism | Vibrio cholerae strain E1162 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | ASZ87_RS17620 | Protein ID | WP_000843587.1 |
Coordinates | 575845..576177 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ASZ87_RS17625 | Protein ID | WP_000071008.1 |
Coordinates | 576164..576478 (+) | Length | 105 a.a. |
Genomic Context
Location: 571286..571489 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 571770..571943 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 572303..572572 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 572890..573061 (172 bp)
Type: Others
Protein ID: Protein_597
Type: Others
Protein ID: Protein_597
Location: 573270..573656 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 573858..574100 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 574271..574648 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 574705..574819 (115 bp)
Type: Others
Protein ID: Protein_601
Type: Others
Protein ID: Protein_601
Location: 574768..575049 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 575215..575328 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 575277..575504 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 575845..576177 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 576164..576478 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 576615..577049 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 577217..577372 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 578545..578851 (307 bp)
Type: Others
Protein ID: Protein_610
Type: Others
Protein ID: Protein_610
Location: 578988..579680 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 579680..580081 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 580051..580194 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 580269..580682 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 580896..581147 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 581137..581424 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 577497..578477 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ87_RS21005 | 571286..571489 | + | 204 | WP_001911745.1 | hypothetical protein | - |
ASZ87_RS20805 | 571770..571943 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
ASZ87_RS17560 | 572303..572572 | + | 270 | WP_001198131.1 | hypothetical protein | - |
ASZ87_RS21165 | 572890..573061 | + | 172 | Protein_597 | DUF645 family protein | - |
ASZ87_RS17575 | 573270..573656 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ87_RS17580 | 573858..574100 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ87_RS17585 | 574271..574648 | + | 378 | WP_000411109.1 | hypothetical protein | - |
ASZ87_RS21130 | 574705..574819 | + | 115 | Protein_601 | acetyltransferase | - |
ASZ87_RS17590 | 574768..575049 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
ASZ87_RS17605 | 575215..575328 | + | 114 | WP_001889158.1 | hypothetical protein | - |
ASZ87_RS17610 | 575277..575504 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
ASZ87_RS17620 | 575845..576177 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ87_RS17625 | 576164..576478 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
ASZ87_RS17630 | 576615..577049 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS20915 | 577217..577372 | + | 156 | WP_000751734.1 | hypothetical protein | - |
ASZ87_RS17645 | 577497..578477 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
ASZ87_RS17650 | 578545..578851 | + | 307 | Protein_610 | CatB-related O-acetyltransferase | - |
ASZ87_RS17655 | 578988..579680 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17660 | 579680..580081 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
ASZ87_RS20820 | 580051..580194 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ASZ87_RS17670 | 580269..580682 | + | 414 | WP_000049417.1 | VOC family protein | - |
ASZ87_RS17675 | 580896..581147 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ87_RS17680 | 581137..581424 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 435534..596659 | 161125 | |
inside | Integron | - | - | 440614..596283 | 155669 | ||
flank | IS/Tn | - | - | 577497..578477 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T58315 WP_000843587.1 NZ_CP013310:575845-576177 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T58315 NZ_CP013310:575845-576177 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT58315 WP_000071008.1 NZ_CP013310:576164-576478 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT58315 NZ_CP013310:576164-576478 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA