Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 377453..377993 | Replicon | chromosome |
Accession | NZ_CP013318 | ||
Organism | Vibrio cholerae strain NCTC5395 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | ASZ85_RS16010 | Protein ID | WP_000277238.1 |
Coordinates | 377453..377722 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | ASZ85_RS16015 | Protein ID | WP_001258569.1 |
Coordinates | 377715..377993 (-) | Length | 93 a.a. |
Genomic Context
Location: 372943..373329 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 373386..373499 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 373448..373729 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 373987..374523 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 374660..375175 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 376484..376609 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 376625..376663 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 376859..377305 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 378243..378500 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 378488..378790 (303 bp)
Type: Others
Protein ID: WP_000229318.1
Type: Others
Protein ID: WP_000229318.1
Location: 379079..379303 (225 bp)
Type: Others
Protein ID: WP_001894423.1
Type: Others
Protein ID: WP_001894423.1
Location: 379747..379866 (120 bp)
Type: Others
Protein ID: WP_071919600.1
Type: Others
Protein ID: WP_071919600.1
Location: 379870..379923 (54 bp)
Type: Others
Protein ID: Protein_360
Type: Others
Protein ID: Protein_360
Location: 380525..381529 (1005 bp)
Type: Others
Protein ID: WP_000964931.1
Type: Others
Protein ID: WP_000964931.1
Location: 382304..382484 (181 bp)
Type: Others
Protein ID: Protein_362
Type: Others
Protein ID: Protein_362
Location: 372457..372699 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 375325..375822 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 375819..376091 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 377453..377722 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 377715..377993 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ85_RS15955 | 372457..372699 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ85_RS15960 | 372943..373329 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
ASZ85_RS15965 | 373386..373499 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ASZ85_RS15970 | 373448..373729 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ASZ85_RS15980 | 373987..374523 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS15985 | 374660..375175 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ASZ85_RS15990 | 375325..375822 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS15995 | 375819..376091 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ85_RS20980 | 376484..376609 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ASZ85_RS20985 | 376625..376663 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ASZ85_RS16005 | 376859..377305 | + | 447 | WP_000006157.1 | hypothetical protein | - |
ASZ85_RS16010 | 377453..377722 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
ASZ85_RS16015 | 377715..377993 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ASZ85_RS16020 | 378243..378500 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ85_RS16025 | 378488..378790 | + | 303 | WP_000229318.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ85_RS16030 | 379079..379303 | + | 225 | WP_001894423.1 | DUF3709 domain-containing protein | - |
ASZ85_RS16035 | 379747..379866 | + | 120 | WP_071919600.1 | DUF645 family protein | - |
ASZ85_RS21000 | 379870..379923 | + | 54 | Protein_360 | DUF645 family protein | - |
ASZ85_RS16050 | 380525..381529 | + | 1005 | WP_000964931.1 | LD-carboxypeptidase | - |
ASZ85_RS16060 | 382304..382484 | + | 181 | Protein_362 | DUF645 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 338285..496833 | 158548 | |
inside | Integron | - | - | 343365..496457 | 153092 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T58395 WP_000277238.1 NZ_CP013318:c377722-377453 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T58395 NZ_CP013318:c377722-377453 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT58395 WP_001258569.1 NZ_CP013318:c377993-377715 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT58395 NZ_CP013318:c377993-377715 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |