Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 972984..973388 | Replicon | chromosome |
Accession | NZ_CP040173 | ||
Organism | Vibrio cholerae strain VC1374 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | FDZ90_RS19335 | Protein ID | WP_001114075.1 |
Coordinates | 973119..973388 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | FDZ90_RS19330 | Protein ID | WP_099607150.1 |
Coordinates | 972984..973088 (+) | Length | 35 a.a. |
Genomic Context
Location: 968486..969403 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 969560..969949 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 970085..970294 (210 bp)
Type: Others
Protein ID: Protein_914
Type: Others
Protein ID: Protein_914
Location: 970413..970850 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 970913..971131 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 971306..972178 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 972328..972927 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 972984..973088 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 973119..973388 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 973382..973903 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 974202..974327 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 974578..974973 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 975865..976380 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 976564..976977 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 975112..975390 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 975387..975671 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FDZ90_RS19295 | 968486..969403 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
FDZ90_RS19300 | 969560..969949 | + | 390 | WP_001081302.1 | hypothetical protein | - |
FDZ90_RS19305 | 970085..970294 | + | 210 | Protein_914 | GNAT family N-acetyltransferase | - |
FDZ90_RS19310 | 970413..970850 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
FDZ90_RS19315 | 970913..971131 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
FDZ90_RS19320 | 971306..972178 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
FDZ90_RS19325 | 972328..972927 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
FDZ90_RS19330 | 972984..973088 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
FDZ90_RS19335 | 973119..973388 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
FDZ90_RS19340 | 973382..973903 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
FDZ90_RS19345 | 974202..974327 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
FDZ90_RS19350 | 974578..974973 | + | 396 | WP_001000867.1 | hypothetical protein | - |
FDZ90_RS19355 | 975112..975390 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
FDZ90_RS19360 | 975387..975671 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
FDZ90_RS19365 | 975865..976380 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
FDZ90_RS19370 | 976564..976977 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 882589..977840 | 95251 | |
inside | Integron | catB9 | - | 887669..977464 | 89795 | ||
flank | IS/Tn | - | - | 970413..970850 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T125050 WP_001114075.1 NZ_CP040173:973119-973388 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T125050 NZ_CP040173:973119-973388 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT125050 WP_099607150.1 NZ_CP040173:972984-973088 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT125050 NZ_CP040173:972984-973088 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |