295389

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 379125..379623 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag OC617_RS15620 Protein ID WP_000589156.1
Coordinates 379125..379391 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag OC617_RS15625 Protein ID WP_000643598.1
Coordinates 379378..379623 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15555 374654..374752 + 99 WP_223225486.1 DUF3709 domain-containing protein -
OC617_RS15560 374952..375053 + 102 WP_001921603.1 hypothetical protein -
OC617_RS15565 (CNRVC190243H_03094) 375043..375429 + 387 WP_000703163.1 VOC family protein -
OC617_RS15570 (CNRVC190243H_03095) 375624..375875 + 252 WP_001890111.1 TIGR03643 family protein -
OC617_RS15575 375848..375997 + 150 WP_071908333.1 DUF3265 domain-containing protein -
OC617_RS15580 (CNRVC190243H_03096) 376089..376331 + 243 WP_000107461.1 hypothetical protein -
OC617_RS15585 376583..376861 + 279 WP_000280324.1 DUF3709 domain-containing protein -
OC617_RS15590 377293..377336 + 44 Protein_340 hypothetical protein -
OC617_RS15595 377318..377411 + 94 Protein_341 ggdef family protein -
OC617_RS15600 377380..377511 + 132 WP_001883067.1 hypothetical protein -
OC617_RS15605 (CNRVC190243H_03097) 377683..378150 + 468 WP_001289288.1 OsmC family protein -
OC617_RS15610 (CNRVC190243H_03098) 378278..378940 + 663 WP_000960654.1 hypothetical protein -
OC617_RS15615 378930..379058 + 129 WP_088124358.1 DUF3265 domain-containing protein -
OC617_RS15620 379125..379391 + 267 WP_000589156.1 BrnT family toxin Toxin
OC617_RS15625 (CNRVC190243H_03099) 379378..379623 + 246 WP_000643598.1 hypothetical protein Antitoxin
OC617_RS15630 (CNRVC190243H_03100) 379719..380513 + 795 WP_001911581.1 hypothetical protein -
OC617_RS15635 380510..380626 + 117 WP_086010881.1 DUF3265 domain-containing protein -
OC617_RS15640 380616..380744 + 129 WP_071908338.1 general secretion pathway protein GspI -
OC617_RS15645 380805..380987 + 183 WP_000923182.1 DUF645 family protein -
OC617_RS15650 (CNRVC190243H_03101) 381203..382207 + 1005 WP_000964920.1 LD-carboxypeptidase -
OC617_RS15655 (CNRVC190243H_03102) 382360..382719 + 360 WP_001071541.1 VOC family protein -
OC617_RS15660 382786..382971 + 186 WP_001999468.1 hypothetical protein -
OC617_RS15665 383103..383225 + 123 WP_001937972.1 DUF3709 domain-containing protein -
OC617_RS15670 (CNRVC190243H_03103) 383493..383999 + 507 WP_000393074.1 hypothetical protein -
OC617_RS15675 (CNRVC190243H_03104) 384156..384542 + 387 WP_000703163.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T295389 WP_000589156.1 NZ_OW443148:379125-379391 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT295389 WP_000643598.1 NZ_OW443148:379378-379623 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References