Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 957028..957661 | Replicon | chromosome |
Accession | NZ_CP040173 | ||
Organism | Vibrio cholerae strain VC1374 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | FDZ90_RS19180 | Protein ID | WP_000843587.1 |
Coordinates | 957028..957360 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FDZ90_RS19185 | Protein ID | WP_000071008.1 |
Coordinates | 957347..957661 (+) | Length | 105 a.a. |
Genomic Context
Location: 952471..952674 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 952955..953128 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 953488..953757 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 954068..954154 (87 bp)
Type: Others
Protein ID: WP_134820423.1
Type: Others
Protein ID: WP_134820423.1
Location: 954154..954246 (93 bp)
Type: Others
Protein ID: Protein_881
Type: Others
Protein ID: Protein_881
Location: 954455..954841 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 955043..955285 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 955455..955832 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 955889..956003 (115 bp)
Type: Others
Protein ID: Protein_885
Type: Others
Protein ID: Protein_885
Location: 955952..956233 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 956398..956511 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 956460..956687 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 957028..957360 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 957347..957661 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 957798..958232 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 958400..958555 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 959727..959999 (273 bp)
Type: Others
Protein ID: Protein_894
Type: Others
Protein ID: Protein_894
Location: 960170..960862 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 960862..961263 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 961233..961376 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 961451..961864 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 962078..962329 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 962319..962606 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 958680..959659 (980 bp)
Type: Others
Protein ID: Protein_893
Type: Others
Protein ID: Protein_893
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FDZ90_RS19120 | 952471..952674 | + | 204 | WP_001911745.1 | hypothetical protein | - |
FDZ90_RS19125 | 952955..953128 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
FDZ90_RS19130 | 953488..953757 | + | 270 | WP_001198131.1 | hypothetical protein | - |
FDZ90_RS19135 | 954068..954154 | + | 87 | WP_134820423.1 | DUF645 family protein | - |
FDZ90_RS19140 | 954154..954246 | + | 93 | Protein_881 | DUF645 family protein | - |
FDZ90_RS19145 | 954455..954841 | + | 387 | WP_000703163.1 | VOC family protein | - |
FDZ90_RS19150 | 955043..955285 | + | 243 | WP_000107461.1 | hypothetical protein | - |
FDZ90_RS19155 | 955455..955832 | + | 378 | WP_000411109.1 | hypothetical protein | - |
FDZ90_RS19160 | 955889..956003 | + | 115 | Protein_885 | acetyltransferase | - |
FDZ90_RS19165 | 955952..956233 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
FDZ90_RS19170 | 956398..956511 | + | 114 | WP_001889158.1 | hypothetical protein | - |
FDZ90_RS19175 | 956460..956687 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
FDZ90_RS19180 | 957028..957360 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FDZ90_RS19185 | 957347..957661 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
FDZ90_RS19190 | 957798..958232 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
FDZ90_RS19195 | 958400..958555 | + | 156 | WP_000751734.1 | hypothetical protein | - |
FDZ90_RS19200 | 958680..959659 | - | 980 | Protein_893 | IS5-like element ISVch5 family transposase | - |
FDZ90_RS19205 | 959727..959999 | + | 273 | Protein_894 | CatB-related O-acetyltransferase | - |
FDZ90_RS19210 | 960170..960862 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
FDZ90_RS19215 | 960862..961263 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
FDZ90_RS19220 | 961233..961376 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
FDZ90_RS19225 | 961451..961864 | + | 414 | WP_000049417.1 | VOC family protein | - |
FDZ90_RS19230 | 962078..962329 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FDZ90_RS19235 | 962319..962606 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 882589..977840 | 95251 | |
inside | Integron | catB9 | - | 887669..977464 | 89795 | ||
flank | IS/Tn | - | - | 958940..959659 | 719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T125044 WP_000843587.1 NZ_CP040173:957028-957360 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T125044 NZ_CP040173:957028-957360 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT125044 WP_000071008.1 NZ_CP040173:957347-957661 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT125044 NZ_CP040173:957347-957661 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA