Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 227978..228506 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | K6J80_RS14920 | Protein ID | WP_000221354.1 |
Coordinates | 227978..228265 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | K6J80_RS14925 | Protein ID | WP_001250179.1 |
Coordinates | 228255..228506 (-) | Length | 84 a.a. |
Genomic Context
Location: 225953..226225 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 226222..226719 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 230925..231905 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 223081..223614 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 223611..223880 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 224103..224474 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 224615..224902 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 225054..225722 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 225739..225801 (63 bp)
Type: Others
Protein ID: Protein_206
Type: Others
Protein ID: Protein_206
Location: 226736..226804 (69 bp)
Type: Others
Protein ID: Protein_209
Type: Others
Protein ID: Protein_209
Location: 226921..227025 (105 bp)
Type: Others
Protein ID: WP_228840819.1
Type: Others
Protein ID: WP_228840819.1
Location: 227216..227338 (123 bp)
Type: Others
Protein ID: Protein_211
Type: Others
Protein ID: Protein_211
Location: 227395..227850 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 227978..228265 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 228255..228506 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 228720..229133 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 229208..229318 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 229321..229722 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 229722..229892 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 230016..230414 (399 bp)
Type: Others
Protein ID: Protein_219
Type: Others
Protein ID: Protein_219
Location: 230551..230857 (307 bp)
Type: Others
Protein ID: Protein_220
Type: Others
Protein ID: Protein_220
Location: 232030..232185 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 232353..232787 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 232924..233238 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS14875 | 223081..223614 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
K6J80_RS18940 | 223611..223880 | - | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
K6J80_RS14885 | 224103..224474 | - | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
K6J80_RS14890 | 224615..224902 | - | 288 | WP_000426470.1 | hypothetical protein | - |
K6J80_RS14895 | 225054..225722 | - | 669 | WP_000043871.1 | hypothetical protein | - |
K6J80_RS18945 | 225739..225801 | - | 63 | Protein_206 | acetyltransferase | - |
K6J80_RS14900 | 225953..226225 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K6J80_RS14905 | 226222..226719 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
K6J80_RS18950 | 226736..226804 | - | 69 | Protein_209 | acetyltransferase | - |
K6J80_RS14910 | 226921..227025 | - | 105 | WP_228840819.1 | DUF645 family protein | - |
K6J80_RS18955 | 227216..227338 | - | 123 | Protein_211 | acetyltransferase | - |
K6J80_RS14915 | 227395..227850 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
K6J80_RS14920 | 227978..228265 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J80_RS14925 | 228255..228506 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
K6J80_RS14930 | 228720..229133 | - | 414 | WP_000049417.1 | VOC family protein | - |
K6J80_RS18960 | 229208..229318 | - | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
K6J80_RS14935 | 229321..229722 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
K6J80_RS18965 | 229722..229892 | - | 171 | WP_001080654.1 | hypothetical protein | - |
K6J80_RS18970 | 230016..230414 | - | 399 | Protein_219 | GNAT family N-acetyltransferase | - |
K6J80_RS14945 | 230551..230857 | - | 307 | Protein_220 | CatB-related O-acetyltransferase | - |
K6J80_RS14950 | 230925..231905 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
K6J80_RS14955 | 232030..232185 | - | 156 | WP_000751734.1 | hypothetical protein | - |
K6J80_RS14960 | 232353..232787 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
K6J80_RS14965 | 232924..233238 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 | ||
flank | IS/Tn | - | - | 230925..231905 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T38673 WP_000221354.1 NZ_AP024554:c228265-227978 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T38673 NZ_AP024554:c228265-227978 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT38673 WP_001250179.1 NZ_AP024554:c228506-228255 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT38673 NZ_AP024554:c228506-228255 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |