Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 103888..104435 | Replicon | chromosome |
Accession | NZ_AP024548 | ||
Organism | Vibrio cholerae strain BCH-01536 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | K6J77_RS14710 | Protein ID | WP_000229317.1 |
Coordinates | 104133..104435 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | K6J77_RS14705 | Protein ID | WP_000861987.1 |
Coordinates | 103888..104145 (+) | Length | 86 a.a. |
Genomic Context
Location: 98917..99372 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 99429..99551 (123 bp)
Type: Others
Protein ID: Protein_188
Type: Others
Protein ID: Protein_188
Location: 99722..99846 (125 bp)
Type: Others
Protein ID: Protein_189
Type: Others
Protein ID: Protein_189
Location: 99963..100031 (69 bp)
Type: Others
Protein ID: Protein_190
Type: Others
Protein ID: Protein_190
Location: 100966..101028 (63 bp)
Type: Others
Protein ID: Protein_193
Type: Others
Protein ID: Protein_193
Location: 101045..101713 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 101865..102152 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 102293..102664 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 102887..103156 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 103153..103686 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 103696..103806 (111 bp)
Type: Others
Protein ID: WP_086010065.1
Type: Others
Protein ID: WP_086010065.1
Location: 103888..104145 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 104133..104435 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 104669..105586 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 105743..106132 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 106268..106477 (210 bp)
Type: Others
Protein ID: Protein_204
Type: Others
Protein ID: Protein_204
Location: 106596..107033 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 107094..107315 (222 bp)
Type: Others
Protein ID: Protein_206
Type: Others
Protein ID: Protein_206
Location: 107490..108362 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 108512..109111 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 109168..109236 (69 bp)
Type: Others
Protein ID: Protein_209
Type: Others
Protein ID: Protein_209
Location: 100048..100545 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 100542..100814 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J77_RS14660 | 98917..99372 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
K6J77_RS19095 | 99429..99551 | + | 123 | Protein_188 | acetyltransferase | - |
K6J77_RS14665 | 99722..99846 | + | 125 | Protein_189 | DUF645 family protein | - |
K6J77_RS19100 | 99963..100031 | + | 69 | Protein_190 | acetyltransferase | - |
K6J77_RS14670 | 100048..100545 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
K6J77_RS14675 | 100542..100814 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K6J77_RS19105 | 100966..101028 | + | 63 | Protein_193 | acetyltransferase | - |
K6J77_RS14680 | 101045..101713 | + | 669 | WP_000043871.1 | hypothetical protein | - |
K6J77_RS14685 | 101865..102152 | + | 288 | WP_000426470.1 | hypothetical protein | - |
K6J77_RS14690 | 102293..102664 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
K6J77_RS19110 | 102887..103156 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
K6J77_RS14700 | 103153..103686 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
K6J77_RS19115 | 103696..103806 | + | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
K6J77_RS14705 | 103888..104145 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
K6J77_RS14710 | 104133..104435 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J77_RS14715 | 104669..105586 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
K6J77_RS14720 | 105743..106132 | + | 390 | WP_001081302.1 | hypothetical protein | - |
K6J77_RS14725 | 106268..106477 | + | 210 | Protein_204 | GNAT family N-acetyltransferase | - |
K6J77_RS14730 | 106596..107033 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
K6J77_RS14735 | 107094..107315 | + | 222 | Protein_206 | GNAT family N-acetyltransferase | - |
K6J77_RS14740 | 107490..108362 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
K6J77_RS14745 | 108512..109111 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
K6J77_RS14750 | 109168..109236 | + | 69 | Protein_209 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 11978..113648 | 101670 | ||
flank | IS/Tn | - | - | 106596..107033 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T38630 WP_000229317.1 NZ_AP024548:104133-104435 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T38630 NZ_AP024548:104133-104435 [Vibrio cholerae]
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT38630 WP_000861987.1 NZ_AP024548:103888-104145 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT38630 NZ_AP024548:103888-104145 [Vibrio cholerae]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |