254471

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 774472..775050 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag NW313_RS17545 Protein ID WP_001180243.1
Coordinates 774472..774789 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag NW313_RS17550 Protein ID WP_000557292.1
Coordinates 774808..775050 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17485 769702..770058 + 357 WP_001094969.1 DUF6404 family protein -
NW313_RS17490 770157..770300 + 144 Protein_721 acetyltransferase -
NW313_RS17495 770423..770542 + 120 WP_001900954.1 DUF645 family protein -
NW313_RS17500 770758..771114 + 357 WP_001094970.1 DUF6404 family protein -
NW313_RS17505 771258..771794 + 537 WP_000644491.1 nucleotidyltransferase family protein -
NW313_RS17510 772145..772207 + 63 Protein_725 DUF645 family protein -
NW313_RS17515 772197..772307 + 111 WP_223804330.1 Tfp pilus assembly protein -
NW313_RS17520 772466..772891 + 426 WP_000403014.1 GNAT family N-acetyltransferase -
NW313_RS17525 773040..773387 + 348 WP_000933409.1 hypothetical protein -
NW313_RS17530 773534..773827 + 294 WP_125460920.1 hypothetical protein -
NW313_RS17535 773890..774065 + 176 Protein_730 acetyltransferase -
NW313_RS17540 774126..774278 + 153 Protein_731 DUF645 family protein -
NW313_RS17545 774472..774789 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NW313_RS17550 774808..775050 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW313_RS17555 775292..775801 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
NW313_RS17560 775858..776511 + 654 WP_000226874.1 hypothetical protein -
NW313_RS17565 776600..776809 + 210 WP_001900246.1 DUF3709 domain-containing protein -
NW313_RS17570 776821..777039 + 219 WP_001917086.1 DUF3709 domain-containing protein -
NW313_RS17575 777228..777421 + 194 Protein_738 hypothetical protein -
NW313_RS17580 777442..777675 + 234 WP_032482776.1 DUF3709 domain-containing protein -
NW313_RS17585 778100..778280 + 181 Protein_740 DUF645 family protein -
NW313_RS17590 778393..778506 + 114 WP_001894955.1 hypothetical protein -
NW313_RS17595 778547..778834 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
NW313_RS17600 778845..779162 + 318 WP_001232701.1 HigA family addiction module antitoxin -
NW313_RS17605 779159..779269 + 111 WP_134814058.1 DUF3265 domain-containing protein -
NW313_RS17610 779308..779418 + 111 Protein_745 acetyltransferase -
NW313_RS17615 779446..779571 + 126 WP_001944767.1 DUF645 family protein -
NW313_RS17620 779534..779650 + 117 WP_001889170.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T254471 WP_001180243.1 NZ_CP102928:c774789-774472 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT254471 WP_000557292.1 NZ_CP102928:c775050-774808 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References