Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 349626..350164 | Replicon | chromosome |
Accession | NZ_LT906615 | ||
Organism | Vibrio cholerae O1 biovar El Tor str. N16961 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | FY484_RS15670 | Protein ID | WP_000802136.1 |
Coordinates | 349626..349925 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | FY484_RS15675 | Protein ID | WP_001107719.1 |
Coordinates | 349922..350164 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FY484_RS15620 | 345561..345743 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
FY484_RS15625 | 345943..346416 | + | 474 | WP_001161076.1 | GrpB family protein | - |
FY484_RS15630 | 346431..346523 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
FY484_RS15635 | 346565..347191 | + | 627 | WP_000365424.1 | LysE family translocator | - |
FY484_RS15640 | 347314..348012 | + | 699 | WP_001890502.1 | hypothetical protein | - |
FY484_RS15645 | 348022..348132 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
FY484_RS15660 | 348710..348889 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
FY484_RS15665 | 349103..349498 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
FY484_RS15670 | 349626..349925 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FY484_RS15675 | 349922..350164 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
FY484_RS15685 | 350393..350971 | + | 579 | WP_000110120.1 | hypothetical protein | - |
FY484_RS15690 | 350993..351085 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
FY484_RS15700 | 351509..352192 | + | 684 | WP_000877436.1 | hypothetical protein | - |
FY484_RS15710 | 352406..352672 | + | 267 | WP_000937852.1 | hypothetical protein | - |
FY484_RS15720 | 352827..353425 | + | 599 | Protein_338 | hypothetical protein | - |
FY484_RS15725 | 353706..354641 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
FY484_RS15730 | 354607..354747 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T293797 WP_000802136.1 NZ_LT906615:c349925-349626 [Vibrio cholerae O1 biovar El Tor str. N16961]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|