294383

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 453979..454745 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag DG176_RS16830 Protein ID WP_000982260.1
Coordinates 454248..454745 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag DG176_RS16825 Protein ID WP_000246253.1
Coordinates 453979..454251 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16755 449476..449718 - 243 WP_000107461.1 hypothetical protein -
DG176_RS16760 449810..449959 - 150 WP_071908333.1 DUF3265 domain-containing protein -
DG176_RS16765 449932..450183 - 252 WP_001890111.1 TIGR03643 family protein -
DG176_RS16770 450378..450764 - 387 WP_000703163.1 VOC family protein -
DG176_RS16775 450754..450855 - 102 WP_001921603.1 hypothetical protein -
DG176_RS16780 451055..451261 - 207 Protein_446 DUF3709 domain-containing protein -
DG176_RS16785 451513..451791 - 279 WP_001921601.1 DUF3709 domain-containing protein -
DG176_RS16795 452077..452355 + 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DG176_RS16800 452348..452617 + 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin -
DG176_RS16805 452765..453211 - 447 WP_000006157.1 hypothetical protein -
DG176_RS16815 453407..453445 - 39 WP_106019118.1 hypothetical protein -
DG176_RS16820 453461..453586 - 126 WP_001900195.1 DUF645 family protein -
DG176_RS16825 453979..454251 + 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
DG176_RS16830 454248..454745 + 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
DG176_RS16835 454895..455410 - 516 WP_001201509.1 lipocalin family protein -
DG176_RS16840 455547..456083 - 537 WP_000469482.1 GNAT family N-acetyltransferase -
DG176_RS16855 456341..456622 - 282 WP_001894429.1 DUF1289 domain-containing protein -
DG176_RS16860 456571..456684 - 114 WP_001900214.1 hypothetical protein -
DG176_RS16865 456741..457127 - 387 WP_001015867.1 NUDIX hydrolase -
DG176_RS16870 457371..457613 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG176_RS16875 457632..457949 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG176_RS16885 458103..458441 - 339 WP_000713853.1 hypothetical protein -
DG176_RS16890 458599..459303 - 705 WP_000087610.1 HNH endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T294383 WP_000982260.1 NZ_LT992489:454248-454745 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT294383 WP_000246253.1 NZ_LT992489:453979-454251 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References