Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 330325..330865 | Replicon | chromosome |
Accession | NZ_CP028828 | ||
Organism | Vibrio cholerae strain N16961 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | N16961_RS15570 | Protein ID | WP_000277238.1 |
Coordinates | 330325..330594 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | N16961_RS15575 | Protein ID | WP_001258569.1 |
Coordinates | 330587..330865 (-) | Length | 93 a.a. |
Genomic Context
Location: 325815..326201 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 326258..326371 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 326320..326601 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 326859..327395 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 327532..328047 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 329356..329481 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 329497..329535 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 329731..330177 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 331151..331429 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 331681..331887 (207 bp)
Type: Others
Protein ID: Protein_294
Type: Others
Protein ID: Protein_294
Location: 332087..332188 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 332178..332564 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 332759..333010 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 332983..333132 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 333224..333466 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 333718..333996 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 334371..334514 (144 bp)
Type: Others
Protein ID: Protein_301
Type: Others
Protein ID: Protein_301
Location: 334568..334606 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 334818..335285 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 325329..325571 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 328197..328694 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 328691..328963 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 330325..330594 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 330587..330865 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N16961_RS15500 | 325329..325571 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N16961_RS15505 | 325815..326201 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
N16961_RS15510 | 326258..326371 | + | 114 | WP_001900214.1 | hypothetical protein | - |
N16961_RS15515 | 326320..326601 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
N16961_RS15530 | 326859..327395 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
N16961_RS15535 | 327532..328047 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
N16961_RS15540 | 328197..328694 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
N16961_RS15545 | 328691..328963 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
N16961_RS15550 | 329356..329481 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
N16961_RS15555 | 329497..329535 | + | 39 | WP_106019118.1 | hypothetical protein | - |
N16961_RS15565 | 329731..330177 | + | 447 | WP_000006157.1 | hypothetical protein | - |
N16961_RS15570 | 330325..330594 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
N16961_RS15575 | 330587..330865 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N16961_RS15585 | 331151..331429 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
N16961_RS15590 | 331681..331887 | + | 207 | Protein_294 | DUF3709 domain-containing protein | - |
N16961_RS15595 | 332087..332188 | + | 102 | WP_001921603.1 | hypothetical protein | - |
N16961_RS15600 | 332178..332564 | + | 387 | WP_000703163.1 | VOC family protein | - |
N16961_RS15605 | 332759..333010 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
N16961_RS15610 | 332983..333132 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
N16961_RS15615 | 333224..333466 | + | 243 | WP_000107461.1 | hypothetical protein | - |
N16961_RS15620 | 333718..333996 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
N16961_RS19805 | 334371..334514 | + | 144 | Protein_301 | DUF645 family protein | - |
N16961_RS19810 | 334568..334606 | + | 39 | WP_082798268.1 | hypothetical protein | - |
N16961_RS15635 | 334818..335285 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306977..438073 | 131096 | |
inside | Integron | - | - | 312057..437697 | 125640 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T104249 WP_000277238.1 NZ_CP028828:c330594-330325 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T104249 NZ_CP028828:c330594-330325 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT104249 WP_001258569.1 NZ_CP028828:c330865-330587 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT104249 NZ_CP028828:c330865-330587 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |