294378

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 420524..421139 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name higB Uniprot ID Q9KMG5
Locus tag DG176_RS16450 Protein ID WP_001162670.1
Coordinates 420852..421139 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DG176_RS16445 Protein ID WP_001232701.1
Coordinates 420524..420841 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16395 415933..416448 - 516 WP_001201528.1 lipocalin family protein -
DG176_RS16400 416585..417061 - 477 WP_001047180.1 GNAT family N-acetyltransferase -
DG176_RS16405 417089..417199 - 111 WP_071917832.1 DUF3265 domain-containing protein -
DG176_RS16410 417196..418125 - 930 WP_000335802.1 hypothetical protein -
DG176_RS16415 418245..418691 - 447 WP_000128977.1 hypothetical protein -
DG176_RS16420 418844..419848 - 1005 WP_000964925.1 LD-carboxypeptidase -
DG176_RS19810 420061..420099 - 39 WP_106019119.1 hypothetical protein -
DG176_RS19815 420115..420240 - 126 WP_001944767.1 DUF645 family protein -
DG176_RS19820 420417..420527 - 111 WP_134814058.1 DUF3265 domain-containing protein -
DG176_RS16445 420524..420841 - 318 WP_001232701.1 HigA family addiction module antidote protein Antitoxin
DG176_RS16450 420852..421139 - 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG176_RS16455 421406..421586 - 181 Protein_392 DUF645 family protein -
DG176_RS16460 422011..422244 - 234 WP_032482776.1 DUF3709 domain-containing protein -
DG176_RS16465 422647..422865 - 219 WP_001917086.1 DUF3709 domain-containing protein -
DG176_RS16470 423175..423828 - 654 WP_000226874.1 hypothetical protein -
DG176_RS16475 423885..424394 - 510 WP_000405987.1 GNAT family N-acetyltransferase -
DG176_RS16480 424636..424878 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG176_RS16485 424897..425214 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG176_RS19825 425408..425503 - 96 WP_001907607.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-95)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11349.95 Da        Isoelectric Point: 6.7187

>T294378 WP_001162670.1 NZ_LT992489:c421139-420852 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY

Download         Length: 288 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT294378 WP_001232701.1 NZ_LT992489:c420841-420524 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F2HI36

Antitoxin

Source ID Structure

References