Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 426029..426576 | Replicon | chromosome |
Accession | NZ_CP047296 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | GTF72_RS16100 | Protein ID | WP_000229317.1 |
Coordinates | 426274..426576 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | GTF72_RS16095 | Protein ID | WP_000861987.1 |
Coordinates | 426029..426286 (+) | Length | 86 a.a. |
Genomic Context
Location: 421058..421513 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421835..421987 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 423186..423854 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 424006..424293 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 424434..424805 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 424872..425297 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 425294..425827 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 426029..426286 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 426274..426576 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 426810..427727 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 427884..428273 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 428409..428618 (210 bp)
Type: Others
Protein ID: Protein_471
Type: Others
Protein ID: Protein_471
Location: 428737..429174 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 429238..429456 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 429631..430503 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 430653..431252 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 431309..431413 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 422189..422686 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 422683..422955 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF72_RS16050 | 421058..421513 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16055 | 421835..421987 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
GTF72_RS16060 | 422189..422686 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16065 | 422683..422955 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GTF72_RS16070 | 423186..423854 | + | 669 | WP_000043871.1 | hypothetical protein | - |
GTF72_RS16075 | 424006..424293 | + | 288 | WP_000426470.1 | hypothetical protein | - |
GTF72_RS16080 | 424434..424805 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
GTF72_RS16085 | 424872..425297 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
GTF72_RS16090 | 425294..425827 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16095 | 426029..426286 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GTF72_RS16100 | 426274..426576 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF72_RS16105 | 426810..427727 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
GTF72_RS16110 | 427884..428273 | + | 390 | WP_001081302.1 | hypothetical protein | - |
GTF72_RS16115 | 428409..428618 | + | 210 | Protein_471 | GNAT family N-acetyltransferase | - |
GTF72_RS16120 | 428737..429174 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
GTF72_RS16125 | 429238..429456 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
GTF72_RS16130 | 429631..430503 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
GTF72_RS16135 | 430653..431252 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
GTF72_RS16140 | 431309..431413 | + | 105 | WP_099607150.1 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306905..436165 | 129260 | |
inside | Integron | - | - | 311985..435789 | 123804 | ||
flank | IS/Tn | - | - | 428737..429174 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T145818 WP_000229317.1 NZ_CP047296:426274-426576 [Vibrio cholerae C6706]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T145818 NZ_CP062700:c3497044-3496889 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT145818 WP_000861987.1 NZ_CP047296:426029-426286 [Vibrio cholerae C6706]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT145818 NZ_CP062700:3497056-3497114 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |