Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 364007..364585 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | IR04_RS01765 | Protein ID | WP_001180243.1 |
Coordinates | 364007..364324 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | IR04_RS01770 | Protein ID | WP_000557292.1 |
Coordinates | 364343..364585 (-) | Length | 81 a.a. |
Genomic Context
Location: 359198..359593 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 359896..360077 (182 bp)
Type: Others
Protein ID: Protein_347
Type: Others
Protein ID: Protein_347
Location: 360254..360649 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 360793..361329 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 361626..361805 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 362001..362426 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 362575..362922 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 363069..363362 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 363718..363813 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 364827..365336 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 365393..366046 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 366356..366574 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 366977..367210 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 367635..367815 (181 bp)
Type: Others
Protein ID: Protein_361
Type: Others
Protein ID: Protein_361
Location: 368082..368369 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 368380..368697 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 368694..368804 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 368981..369106 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 369122..369160 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 364007..364324 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 364343..364585 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS01730 | 359198..359593 | + | 396 | WP_000046952.1 | hypothetical protein | - |
IR04_RS19280 | 359896..360077 | + | 182 | Protein_347 | DUF645 family protein | - |
IR04_RS01735 | 360254..360649 | + | 396 | WP_000046953.1 | hypothetical protein | - |
IR04_RS01740 | 360793..361329 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
IR04_RS01750 | 361626..361805 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
IR04_RS01755 | 362001..362426 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
IR04_RS01760 | 362575..362922 | + | 348 | WP_000933409.1 | hypothetical protein | - |
IR04_RS20205 | 363069..363362 | + | 294 | WP_125460920.1 | hypothetical protein | - |
IR04_RS20395 | 363718..363813 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
IR04_RS01765 | 364007..364324 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IR04_RS01770 | 364343..364585 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
IR04_RS01775 | 364827..365336 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
IR04_RS01780 | 365393..366046 | + | 654 | WP_000226874.1 | hypothetical protein | - |
IR04_RS01785 | 366356..366574 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
IR04_RS19310 | 366977..367210 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
IR04_RS01790 | 367635..367815 | + | 181 | Protein_361 | DUF645 family protein | - |
IR04_RS01795 | 368082..368369 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
IR04_RS01800 | 368380..368697 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
IR04_RS20400 | 368694..368804 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
IR04_RS20405 | 368981..369106 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
IR04_RS20410 | 369122..369160 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T48151 WP_001180243.1 NZ_CP009041:c364324-364007 [Vibrio cholerae O1 biovar El Tor]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T48151 NZ_CP009041:c364324-364007 [Vibrio cholerae O1 biovar El Tor]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT48151 WP_000557292.1 NZ_CP009041:c364585-364343 [Vibrio cholerae O1 biovar El Tor]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT48151 NZ_CP009041:c364585-364343 [Vibrio cholerae O1 biovar El Tor]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |