Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 529713..530291 | Replicon | chromosome |
Accession | NZ_CP013310 | ||
Organism | Vibrio cholerae strain E1162 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ASZ87_RS17155 | Protein ID | WP_001180243.1 |
Coordinates | 529713..530030 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ASZ87_RS17160 | Protein ID | WP_000557292.1 |
Coordinates | 530049..530291 (-) | Length | 81 a.a. |
Genomic Context
Location: 524904..525299 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 525602..525783 (182 bp)
Type: Others
Protein ID: Protein_520
Type: Others
Protein ID: Protein_520
Location: 525960..526355 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 526499..527035 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 527332..527511 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 527707..528132 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 528281..528628 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 528775..529068 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 529424..529519 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 530533..531042 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 531099..531752 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 532062..532280 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 532683..532916 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 533341..533521 (181 bp)
Type: Others
Protein ID: Protein_534
Type: Others
Protein ID: Protein_534
Location: 533788..534075 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 534086..534403 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 534400..534510 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 534687..534812 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 534828..534866 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 529713..530030 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 530049..530291 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ87_RS17105 | 524904..525299 | + | 396 | WP_000046952.1 | hypothetical protein | - |
ASZ87_RS17110 | 525602..525783 | + | 182 | Protein_520 | DUF645 family protein | - |
ASZ87_RS17115 | 525960..526355 | + | 396 | WP_000046953.1 | hypothetical protein | - |
ASZ87_RS17120 | 526499..527035 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ87_RS17125 | 527332..527511 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
ASZ87_RS17130 | 527707..528132 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17135 | 528281..528628 | + | 348 | WP_000933409.1 | hypothetical protein | - |
ASZ87_RS20720 | 528775..529068 | + | 294 | WP_125460920.1 | hypothetical protein | - |
ASZ87_RS21085 | 529424..529519 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
ASZ87_RS17155 | 529713..530030 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ87_RS17160 | 530049..530291 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ87_RS17165 | 530533..531042 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
ASZ87_RS17170 | 531099..531752 | + | 654 | WP_000226874.1 | hypothetical protein | - |
ASZ87_RS17175 | 532062..532280 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
ASZ87_RS17185 | 532683..532916 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
ASZ87_RS17190 | 533341..533521 | + | 181 | Protein_534 | DUF645 family protein | - |
ASZ87_RS17195 | 533788..534075 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ87_RS17200 | 534086..534403 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ASZ87_RS21090 | 534400..534510 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ASZ87_RS21095 | 534687..534812 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
ASZ87_RS21100 | 534828..534866 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 435534..596659 | 161125 | |
inside | Integron | - | - | 440614..596283 | 155669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T58312 WP_001180243.1 NZ_CP013310:c530030-529713 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T58312 NZ_CP013310:c530030-529713 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT58312 WP_000557292.1 NZ_CP013310:c530291-530049 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT58312 NZ_CP013310:c530291-530049 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |