Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 361538..362078 | Replicon | chromosome |
Accession | NZ_CP013302 | ||
Organism | Vibrio cholerae strain C5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | ASZ80_RS16060 | Protein ID | WP_000277238.1 |
Coordinates | 361538..361807 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | ASZ80_RS16065 | Protein ID | WP_001258569.1 |
Coordinates | 361800..362078 (-) | Length | 93 a.a. |
Genomic Context
Location: 357028..357414 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 357471..357584 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 357533..357814 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 358072..358608 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 358745..359260 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 360569..360694 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 360710..360748 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 360944..361390 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 362364..362642 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 362894..363100 (207 bp)
Type: Others
Protein ID: Protein_348
Type: Others
Protein ID: Protein_348
Location: 363300..363401 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 363391..363777 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 363972..364223 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 364196..364345 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 364437..364679 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 364931..365209 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 365584..365727 (144 bp)
Type: Others
Protein ID: Protein_355
Type: Others
Protein ID: Protein_355
Location: 365781..365819 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 366031..366498 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 356542..356784 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 359410..359907 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 359904..360176 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 361538..361807 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 361800..362078 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ80_RS16005 | 356542..356784 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ80_RS16010 | 357028..357414 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
ASZ80_RS16015 | 357471..357584 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ASZ80_RS16020 | 357533..357814 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ASZ80_RS16030 | 358072..358608 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ASZ80_RS16035 | 358745..359260 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ASZ80_RS16040 | 359410..359907 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ80_RS16045 | 359904..360176 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ80_RS20495 | 360569..360694 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ASZ80_RS20500 | 360710..360748 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ASZ80_RS16055 | 360944..361390 | + | 447 | WP_000006157.1 | hypothetical protein | - |
ASZ80_RS16060 | 361538..361807 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
ASZ80_RS16065 | 361800..362078 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ASZ80_RS16070 | 362364..362642 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
ASZ80_RS20515 | 362894..363100 | + | 207 | Protein_348 | DUF3709 domain-containing protein | - |
ASZ80_RS20520 | 363300..363401 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ80_RS16075 | 363391..363777 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ80_RS16080 | 363972..364223 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ80_RS16085 | 364196..364345 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ80_RS16090 | 364437..364679 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ80_RS16095 | 364931..365209 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
ASZ80_RS20950 | 365584..365727 | + | 144 | Protein_355 | DUF645 family protein | - |
ASZ80_RS20955 | 365781..365819 | + | 39 | WP_082798268.1 | hypothetical protein | - |
ASZ80_RS16110 | 366031..366498 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304694..469286 | 164592 | |
inside | Integron | - | - | 309774..468910 | 159136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T58220 WP_000277238.1 NZ_CP013302:c361807-361538 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T58220 NZ_CP013302:c361807-361538 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT58220 WP_001258569.1 NZ_CP013302:c362078-361800 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT58220 NZ_CP013302:c362078-361800 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |