294409

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 225675..226173 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag DG169_RS15540 Protein ID WP_000589156.1
Coordinates 225675..225941 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag DG169_RS15545 Protein ID WP_000643598.1
Coordinates 225928..226173 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS15480 221096..221302 + 207 Protein_208 DUF3709 domain-containing protein -
DG169_RS15485 221502..221603 + 102 WP_001921603.1 hypothetical protein -
DG169_RS15490 221593..221979 + 387 WP_000703163.1 VOC family protein -
DG169_RS15495 222174..222425 + 252 WP_001890111.1 TIGR03643 family protein -
DG169_RS15500 222398..222547 + 150 WP_071908333.1 DUF3265 domain-containing protein -
DG169_RS15505 222639..222881 + 243 WP_000107461.1 hypothetical protein -
DG169_RS15510 223133..223411 + 279 WP_000280324.1 DUF3709 domain-containing protein -
DG169_RS19815 223786..223929 + 144 Protein_215 DUF645 family protein -
DG169_RS19820 223983..224021 + 39 WP_082798268.1 hypothetical protein -
DG169_RS15525 224233..224700 + 468 WP_001289288.1 OsmC family protein -
DG169_RS15530 224828..225490 + 663 WP_000960654.1 hypothetical protein -
DG169_RS15540 225675..225941 + 267 WP_000589156.1 BrnT family toxin Toxin
DG169_RS15545 225928..226173 + 246 WP_000643598.1 hypothetical protein Antitoxin
DG169_RS15550 226269..227063 + 795 WP_001911581.1 hypothetical protein -
DG169_RS19825 227166..227294 + 129 WP_071908338.1 general secretion pathway protein GspI -
DG169_RS15565 227355..227537 + 183 WP_000923182.1 DUF645 family protein -
DG169_RS15570 227737..228210 + 474 WP_001161076.1 GrpB family protein -
DG169_RS15575 228225..228317 + 93 WP_014378730.1 DUF3265 domain-containing protein -
DG169_RS15580 228359..228985 + 627 WP_000365424.1 LysE family translocator -
DG169_RS15585 229108..229806 + 699 WP_001890502.1 hypothetical protein -
DG169_RS15590 229816..229926 + 111 WP_079857360.1 DUF3265 domain-containing protein -
DG169_RS15605 230504..230683 + 180 WP_001883058.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T294409 WP_000589156.1 NZ_LT992493:225675-225941 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT294409 WP_000643598.1 NZ_LT992493:225928-226173 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References