Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DhiAT/-
Location 901462..902246 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name dhiT Uniprot ID A0A086SLD6
Locus tag DG247_RS18370 Protein ID WP_001114075.1
Coordinates 901977..902246 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name dhiA Uniprot ID Q9KM84
Locus tag DG247_RS18365 Protein ID WP_000921691.1
Coordinates 901462..901983 (-) Length 174 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18325 898388..898801 - 414 WP_000049420.1 VOC family protein -
DG247_RS18335 898985..899500 - 516 WP_000343779.1 GNAT family N-acetyltransferase -
DG247_RS18340 899694..899978 + 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DG247_RS18345 899975..900253 + 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
DG247_RS18350 900392..900787 - 396 WP_001000867.1 hypothetical protein -
DG247_RS18360 901038..901163 - 126 WP_001905700.1 DUF645 family protein -
DG247_RS18365 901462..901983 - 522 WP_000921691.1 DUF2442 domain-containing protein Antitoxin
DG247_RS18370 901977..902246 - 270 WP_001114075.1 DUF4160 domain-containing protein Toxin
DG247_RS18375 902277..902381 - 105 WP_099607150.1 acetyltransferase -
DG247_RS18380 902438..903037 - 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
DG247_RS18385 903187..904059 - 873 WP_000254716.1 DUF3800 domain-containing protein -
DG247_RS18390 904234..904452 - 219 WP_071908318.1 GNAT family N-acetyltransferase -
DG247_RS18395 904516..904953 - 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
DG247_RS18400 905072..905281 - 210 Protein_767 GNAT family N-acetyltransferase -
DG247_RS18405 905417..905806 - 390 WP_001081302.1 hypothetical protein -
DG247_RS18410 905963..906880 - 918 WP_000186333.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808
flank IS/Tn - - 904516..904953 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF4160

(9-74)

Antitoxin

Protein of unknown function DUF2442

(4-59)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10310.94 Da        Isoelectric Point: 6.6303

>T294349 WP_001114075.1 NZ_LT992487:c902246-901977 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC

Download         Length: 270 bp

Antitoxin


Download         Length: 174 a.a.        Molecular weight: 19409.01 Da        Isoelectric Point: 6.7342

>AT294349 WP_000921691.1 NZ_LT992487:c901983-901462 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI

Download         Length: 522 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A086SLD6

Antitoxin

Source ID Structure
AlphaFold DB Q9KM84

References