Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DhiAT/- |
Location | 901462..902246 | Replicon | chromosome |
Accession | NZ_LT992487 | ||
Organism | Vibrio cholerae strain 4295STDY6534216 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | DG247_RS18370 | Protein ID | WP_001114075.1 |
Coordinates | 901977..902246 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | dhiA | Uniprot ID | Q9KM84 |
Locus tag | DG247_RS18365 | Protein ID | WP_000921691.1 |
Coordinates | 901462..901983 (-) | Length | 174 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG247_RS18325 | 898388..898801 | - | 414 | WP_000049420.1 | VOC family protein | - |
DG247_RS18335 | 898985..899500 | - | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
DG247_RS18340 | 899694..899978 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
DG247_RS18345 | 899975..900253 | + | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
DG247_RS18350 | 900392..900787 | - | 396 | WP_001000867.1 | hypothetical protein | - |
DG247_RS18360 | 901038..901163 | - | 126 | WP_001905700.1 | DUF645 family protein | - |
DG247_RS18365 | 901462..901983 | - | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
DG247_RS18370 | 901977..902246 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
DG247_RS18375 | 902277..902381 | - | 105 | WP_099607150.1 | acetyltransferase | - |
DG247_RS18380 | 902438..903037 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
DG247_RS18385 | 903187..904059 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
DG247_RS18390 | 904234..904452 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
DG247_RS18395 | 904516..904953 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
DG247_RS18400 | 905072..905281 | - | 210 | Protein_767 | GNAT family N-acetyltransferase | - |
DG247_RS18405 | 905417..905806 | - | 390 | WP_001081302.1 | hypothetical protein | - |
DG247_RS18410 | 905963..906880 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
inside | Integron | catB9 | - | 897901..987709 | 89808 | ||
flank | IS/Tn | - | - | 904516..904953 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T294349 WP_001114075.1 NZ_LT992487:c902246-901977 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT294349 WP_000921691.1 NZ_LT992487:c901983-901462 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM84 |