Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 342237..342870 | Replicon | chromosome |
Accession | NZ_CP046841 | ||
Organism | Vibrio cholerae strain F9993 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | GPY07_RS15915 | Protein ID | WP_000843587.1 |
Coordinates | 342538..342870 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GPY07_RS15910 | Protein ID | WP_000071008.1 |
Coordinates | 342237..342551 (-) | Length | 105 a.a. |
Genomic Context
Location: 340238..341218 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 337291..337578 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 337568..337819 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 338033..338446 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 338521..338664 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 338634..339035 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 339035..339727 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 339864..340170 (307 bp)
Type: Others
Protein ID: Protein_310
Type: Others
Protein ID: Protein_310
Location: 341343..341498 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 341666..342100 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 342237..342551 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 342538..342870 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 343211..343438 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 343387..343500 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 343666..343947 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 343896..344010 (115 bp)
Type: Others
Protein ID: Protein_319
Type: Others
Protein ID: Protein_319
Location: 344067..344444 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 344615..344857 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 345059..345445 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 345654..345825 (172 bp)
Type: Others
Protein ID: Protein_323
Type: Others
Protein ID: Protein_323
Location: 346143..346412 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 346772..346945 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 347226..347429 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPY07_RS15860 | 337291..337578 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GPY07_RS15865 | 337568..337819 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GPY07_RS15870 | 338033..338446 | - | 414 | WP_000049417.1 | VOC family protein | - |
GPY07_RS15875 | 338521..338664 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GPY07_RS15880 | 338634..339035 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GPY07_RS15885 | 339035..339727 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
GPY07_RS15890 | 339864..340170 | - | 307 | Protein_310 | CatB-related O-acetyltransferase | - |
GPY07_RS15895 | 340238..341218 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GPY07_RS15900 | 341343..341498 | - | 156 | WP_000751734.1 | hypothetical protein | - |
GPY07_RS15905 | 341666..342100 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GPY07_RS15910 | 342237..342551 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
GPY07_RS15915 | 342538..342870 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GPY07_RS15925 | 343211..343438 | - | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GPY07_RS15930 | 343387..343500 | - | 114 | WP_001889158.1 | hypothetical protein | - |
GPY07_RS15940 | 343666..343947 | - | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
GPY07_RS19435 | 343896..344010 | - | 115 | Protein_319 | acetyltransferase | - |
GPY07_RS15945 | 344067..344444 | - | 378 | WP_000411109.1 | hypothetical protein | - |
GPY07_RS15950 | 344615..344857 | - | 243 | WP_000107461.1 | hypothetical protein | - |
GPY07_RS15955 | 345059..345445 | - | 387 | WP_000703163.1 | VOC family protein | - |
GPY07_RS15960 | 345654..345825 | - | 172 | Protein_323 | DUF645 family protein | - |
GPY07_RS15965 | 346143..346412 | - | 270 | WP_001198131.1 | hypothetical protein | - |
GPY07_RS15970 | 346772..346945 | - | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
GPY07_RS19440 | 347226..347429 | - | 204 | WP_001911745.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 322056..419024 | 96968 | |
inside | Integron | - | - | 322432..412236 | 89804 | ||
flank | IS/Tn | - | - | 340238..341218 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T145064 WP_000843587.1 NZ_CP046841:c342870-342538 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T145064 NZ_CP062252:4184492-4184836 [Pseudomonas allokribbensis]
ATGGATGCTCTTTTTATCGAATTACCCGCGTTCCAGAAGCACCGGGACGATTACCTGGATGATGATTTGTTCCGCAGCTT
TCAATTAGAGCTGCTGAAAAATCCCGAAGCGGGCGATCTCATCGAAGGAACGGGTGGGCTGCGTAAAATTCGCTTCTGCG
ACCAACGACGCGGTAAAGGCAAGCGCAGCGGATTACGAGTGATTTATTACTGGTGGTCTGGTTTCGACCAATTCTGGCTG
TTCACCGTGTACAGCAAAAACGAGCAAGACGATCTGTTGCCTTCCCAGAAAAGAGTCTTCAAACAGGCTCTGGATACAGA
AATCAACACGAGAACCCAAATATGA
ATGGATGCTCTTTTTATCGAATTACCCGCGTTCCAGAAGCACCGGGACGATTACCTGGATGATGATTTGTTCCGCAGCTT
TCAATTAGAGCTGCTGAAAAATCCCGAAGCGGGCGATCTCATCGAAGGAACGGGTGGGCTGCGTAAAATTCGCTTCTGCG
ACCAACGACGCGGTAAAGGCAAGCGCAGCGGATTACGAGTGATTTATTACTGGTGGTCTGGTTTCGACCAATTCTGGCTG
TTCACCGTGTACAGCAAAAACGAGCAAGACGATCTGTTGCCTTCCCAGAAAAGAGTCTTCAAACAGGCTCTGGATACAGA
AATCAACACGAGAACCCAAATATGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT145064 WP_000071008.1 NZ_CP046841:c342551-342237 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT145064 NZ_CP062252:4184833-4185147 [Pseudomonas allokribbensis]
ATGAAACGTGACATTTTTTCCGAACTGATGGAGGGCCTTGAGGCTTTGGCCGACGAGCGCCAGGGCAAGGTCACCCTTCG
CACCCACAAAGTCCAGTTACCAAAACTATTGCCGATCACTGCCGAGGAAGTTGTTGCGATCCGCCAGCAACTCAACCTCT
CCCGGTCAGTTTTCGCCATGTACCTGCGAACCAACACTCGAACCCTCGAAAACTGGGAACAAGGTCGAGCAACGCCAAAT
GCCCAAGCGACGACACTCATTCGACTGGTCGAGCGTTTTCCACAAACGATCGACCACCTTGCGGCTCTGACCTGA
ATGAAACGTGACATTTTTTCCGAACTGATGGAGGGCCTTGAGGCTTTGGCCGACGAGCGCCAGGGCAAGGTCACCCTTCG
CACCCACAAAGTCCAGTTACCAAAACTATTGCCGATCACTGCCGAGGAAGTTGTTGCGATCCGCCAGCAACTCAACCTCT
CCCGGTCAGTTTTCGCCATGTACCTGCGAACCAACACTCGAACCCTCGAAAACTGGGAACAAGGTCGAGCAACGCCAAAT
GCCCAAGCGACGACACTCATTCGACTGGTCGAGCGTTTTCCACAAACGATCGACCACCTTGCGGCTCTGACCTGA