Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | DhiAT/- |
Location | 431441..432225 | Replicon | chromosome |
Accession | NZ_CP047298 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain C6709 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | GTF73_RS16170 | Protein ID | WP_001114075.1 |
Coordinates | 431441..431710 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | dhiA | Uniprot ID | Q9KM84 |
Locus tag | GTF73_RS16175 | Protein ID | WP_000921691.1 |
Coordinates | 431704..432225 (+) | Length | 174 a.a. |
Genomic Context
Location: 426807..427724 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 427881..428270 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 428406..428615 (210 bp)
Type: Others
Protein ID: Protein_471
Type: Others
Protein ID: Protein_471
Location: 428734..429171 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 429235..429453 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 429628..430500 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 430650..431249 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 431306..431410 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 431441..431710 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 431704..432225 (522 bp)
Type: Antitoxin
Protein ID: WP_000921691.1
Type: Antitoxin
Protein ID: WP_000921691.1
Location: 432524..432649 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 432900..433295 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 434187..434702 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 434759..434854 (96 bp)
Type: Others
Protein ID: WP_099607151.1
Type: Others
Protein ID: WP_099607151.1
Location: 434886..435299 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 435854..437031 (1178 bp)
Type: Others
Protein ID: WP_086010879.1
Type: Others
Protein ID: WP_086010879.1
Location: 433434..433712 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 433709..433993 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 435306..435438 (133 bp)
Type: Others
Protein ID: Protein_486
Type: Others
Protein ID: Protein_486
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF73_RS16130 | 426807..427724 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
GTF73_RS16135 | 427881..428270 | + | 390 | WP_001081302.1 | hypothetical protein | - |
GTF73_RS16140 | 428406..428615 | + | 210 | Protein_471 | GNAT family N-acetyltransferase | - |
GTF73_RS16145 | 428734..429171 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
GTF73_RS16150 | 429235..429453 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
GTF73_RS16155 | 429628..430500 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
GTF73_RS16160 | 430650..431249 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
GTF73_RS16165 | 431306..431410 | + | 105 | WP_099607150.1 | acetyltransferase | - |
GTF73_RS16170 | 431441..431710 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
GTF73_RS16175 | 431704..432225 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
GTF73_RS16180 | 432524..432649 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
GTF73_RS16185 | 432900..433295 | + | 396 | WP_001000867.1 | hypothetical protein | - |
GTF73_RS16190 | 433434..433712 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
GTF73_RS16195 | 433709..433993 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
GTF73_RS16200 | 434187..434702 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
GTF73_RS16205 | 434759..434854 | + | 96 | WP_099607151.1 | acetyltransferase | - |
GTF73_RS16210 | 434886..435299 | + | 414 | WP_000049420.1 | VOC family protein | - |
GTF73_RS16215 | 435306..435438 | - | 133 | Protein_486 | hypothetical protein | - |
GTF73_RS16220 | 435854..437031 | + | 1178 | WP_086010879.1 | IS3-like element ISVch4 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306901..436162 | 129261 | |
inside | Integron | - | - | 311981..435786 | 123805 | ||
flank | IS/Tn | - | - | 428734..429171 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T145840 WP_001114075.1 NZ_CP047298:431441-431710 [Vibrio cholerae O1 biovar El Tor]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T145840 NZ_CP062702:2288914-2289017 [Escherichia coli O157:H7]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT145840 WP_000921691.1 NZ_CP047298:431704-432225 [Vibrio cholerae O1 biovar El Tor]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
>AT145840 NZ_CP062702:c2289055-2288784 [Escherichia coli O157:H7]
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM84 |