Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 368879..369457 | Replicon | chromosome |
Accession | NZ_CP047300 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain P27459 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | GTF71_RS15265 | Protein ID | WP_001180243.1 |
Coordinates | 368879..369196 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | GTF71_RS15270 | Protein ID | WP_000557292.1 |
Coordinates | 369215..369457 (-) | Length | 81 a.a. |
Genomic Context
Location: 364109..364465 (357 bp)
Type: Others
Protein ID: WP_001094969.1
Type: Others
Protein ID: WP_001094969.1
Location: 364768..364949 (182 bp)
Type: Others
Protein ID: Protein_355
Type: Others
Protein ID: Protein_355
Location: 365126..365521 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 365665..366201 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 366498..366677 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 366873..367298 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 367447..367794 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 367941..368234 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 368590..368685 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 369699..370208 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 370265..370918 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 371228..371446 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 371849..372082 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 372507..372687 (181 bp)
Type: Others
Protein ID: Protein_369
Type: Others
Protein ID: Protein_369
Location: 372954..373241 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 373252..373569 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 373566..373676 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 373853..373978 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 373994..374032 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 368879..369196 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 369215..369457 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF71_RS15220 | 364109..364465 | + | 357 | WP_001094969.1 | hypothetical protein | - |
GTF71_RS15225 | 364768..364949 | + | 182 | Protein_355 | DUF645 family protein | - |
GTF71_RS15230 | 365126..365521 | + | 396 | WP_000046953.1 | hypothetical protein | - |
GTF71_RS15235 | 365665..366201 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
GTF71_RS15240 | 366498..366677 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
GTF71_RS15245 | 366873..367298 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
GTF71_RS15250 | 367447..367794 | + | 348 | WP_000933409.1 | hypothetical protein | - |
GTF71_RS15255 | 367941..368234 | + | 294 | WP_125460920.1 | hypothetical protein | - |
GTF71_RS15260 | 368590..368685 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
GTF71_RS15265 | 368879..369196 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF71_RS15270 | 369215..369457 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GTF71_RS15275 | 369699..370208 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
GTF71_RS15280 | 370265..370918 | + | 654 | WP_000226874.1 | hypothetical protein | - |
GTF71_RS15285 | 371228..371446 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
GTF71_RS15290 | 371849..372082 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
GTF71_RS15295 | 372507..372687 | + | 181 | Protein_369 | DUF645 family protein | - |
GTF71_RS15300 | 372954..373241 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTF71_RS15305 | 373252..373569 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
GTF71_RS15310 | 373566..373676 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
GTF71_RS15315 | 373853..373978 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
GTF71_RS15320 | 373994..374032 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306926..439292 | 132366 | |
inside | Integron | - | - | 312006..438916 | 126910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T145849 WP_001180243.1 NZ_CP047300:c369196-368879 [Vibrio cholerae O1 biovar El Tor]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T145849 NZ_CP062702:c3588891-3588514 [Escherichia coli O157:H7]
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCACGCCCGTCTCCGGTTGAAATCTGGCAGATACTGCTGTC
CCGACTGCTGGACCAGCACTACGGCCTCACACTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGCGATGCGGTGAACTTTCTCGTTGAAAAATACGCCCTGGTACGTACCGACCAGCCGGGATTC
AGCGCCTGTACCTGCTCTCAGTTAATCAACAGTATCGATATCCTCCGGGCACGCCGGGCAACCGGCCTGATGACACGCGA
CAACTACAGAACGGTAAATAACATTACCCTGGGTAAACATCCGGGGGTGAAACAATGA
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCACGCCCGTCTCCGGTTGAAATCTGGCAGATACTGCTGTC
CCGACTGCTGGACCAGCACTACGGCCTCACACTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGCGATGCGGTGAACTTTCTCGTTGAAAAATACGCCCTGGTACGTACCGACCAGCCGGGATTC
AGCGCCTGTACCTGCTCTCAGTTAATCAACAGTATCGATATCCTCCGGGCACGCCGGGCAACCGGCCTGATGACACGCGA
CAACTACAGAACGGTAAATAACATTACCCTGGGTAAACATCCGGGGGTGAAACAATGA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT145849 WP_000557292.1 NZ_CP047300:c369457-369215 [Vibrio cholerae O1 biovar El Tor]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT145849 NZ_CP062702:c3589349-3588981 [Escherichia coli O157:H7]
GTGTCAGACACGCTCCATGAAACAAATCACCCCGACGGCAATAACAACAGCCCCTGGTGGGGGCTGCCCTGTACCGTGAC
ACCTTGTTTTGGCGCCCGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGCAGACCGTGCCGGTATCAGAGGGCAGT
TCAGCGACGCGGATGTATACCATCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCGAAGCCGACACCCTCGGCAGTTG
TGGTTACGTTTATCTGGCTGTTTATCCAACATCCAAAACGAAAAAGTAA
GTGTCAGACACGCTCCATGAAACAAATCACCCCGACGGCAATAACAACAGCCCCTGGTGGGGGCTGCCCTGTACCGTGAC
ACCTTGTTTTGGCGCCCGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGCAGACCGTGCCGGTATCAGAGGGCAGT
TCAGCGACGCGGATGTATACCATCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCGAAGCCGACACCCTCGGCAGTTG
TGGTTACGTTTATCTGGCTGTTTATCCAACATCCAAAACGAAAAAGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |