Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 415361..415994 | Replicon | chromosome |
Accession | NZ_CP028895 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | A1552VC_RS16740 | Protein ID | WP_000843587.1 |
Coordinates | 415361..415693 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | A1552VC_RS16745 | Protein ID | WP_000071008.1 |
Coordinates | 415680..415994 (+) | Length | 105 a.a. |
Genomic Context
Location: 410802..411005 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 411286..411459 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 411819..412088 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 412406..412577 (172 bp)
Type: Others
Protein ID: Protein_432
Type: Others
Protein ID: Protein_432
Location: 412786..413172 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 413374..413616 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 413787..414164 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 414221..414335 (115 bp)
Type: Others
Protein ID: Protein_436
Type: Others
Protein ID: Protein_436
Location: 414284..414565 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 414731..414844 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 414793..415020 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 415361..415693 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 415680..415994 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 416131..416565 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416733..416888 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 418061..418367 (307 bp)
Type: Others
Protein ID: Protein_445
Type: Others
Protein ID: Protein_445
Location: 418504..419196 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 419196..419597 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 419567..419710 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419785..420198 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 420412..420663 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420653..420940 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 417013..417993 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A1552VC_RS19970 | 410802..411005 | + | 204 | WP_001911745.1 | hypothetical protein | - |
A1552VC_RS16670 | 411286..411459 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
A1552VC_RS16675 | 411819..412088 | + | 270 | WP_001198131.1 | hypothetical protein | - |
A1552VC_RS20140 | 412406..412577 | + | 172 | Protein_432 | DUF645 family protein | - |
A1552VC_RS16690 | 412786..413172 | + | 387 | WP_000703163.1 | VOC family protein | - |
A1552VC_RS16695 | 413374..413616 | + | 243 | WP_000107461.1 | hypothetical protein | - |
A1552VC_RS16700 | 413787..414164 | + | 378 | WP_000411109.1 | hypothetical protein | - |
A1552VC_RS20145 | 414221..414335 | + | 115 | Protein_436 | acetyltransferase | - |
A1552VC_RS16705 | 414284..414565 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
A1552VC_RS16720 | 414731..414844 | + | 114 | WP_001889158.1 | hypothetical protein | - |
A1552VC_RS16725 | 414793..415020 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
A1552VC_RS16740 | 415361..415693 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
A1552VC_RS16745 | 415680..415994 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
A1552VC_RS16750 | 416131..416565 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
A1552VC_RS19895 | 416733..416888 | + | 156 | WP_000751734.1 | hypothetical protein | - |
A1552VC_RS16755 | 417013..417993 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
A1552VC_RS16760 | 418061..418367 | + | 307 | Protein_445 | CatB-related O-acetyltransferase | - |
A1552VC_RS16765 | 418504..419196 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
A1552VC_RS16770 | 419196..419597 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
A1552VC_RS16775 | 419567..419710 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
A1552VC_RS16780 | 419785..420198 | + | 414 | WP_000049417.1 | VOC family protein | - |
A1552VC_RS16785 | 420412..420663 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
A1552VC_RS16790 | 420653..420940 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306914..436175 | 129261 | |
inside | Integron | - | - | 311994..435799 | 123805 | ||
flank | IS/Tn | - | - | 417013..417993 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T104344 WP_000843587.1 NZ_CP028895:415361-415693 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T104344 NZ_CP028895:415361-415693 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT104344 WP_000071008.1 NZ_CP028895:415680-415994 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT104344 NZ_CP028895:415680-415994 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA