294381

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 446184..446682 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag DG176_RS16715 Protein ID WP_000589156.1
Coordinates 446416..446682 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag DG176_RS16710 Protein ID WP_000643598.1
Coordinates 446184..446429 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16650 441674..441853 - 180 WP_001883058.1 DUF645 family protein -
DG176_RS16665 442431..442541 - 111 WP_079857360.1 DUF3265 domain-containing protein -
DG176_RS16670 442551..443249 - 699 WP_001890502.1 hypothetical protein -
DG176_RS16675 443372..443998 - 627 WP_000365424.1 LysE family translocator -
DG176_RS16680 444040..444132 - 93 WP_014378730.1 DUF3265 domain-containing protein -
DG176_RS16685 444147..444620 - 474 WP_001161076.1 GrpB family protein -
DG176_RS16690 444820..445002 - 183 WP_000923182.1 DUF645 family protein -
DG176_RS19830 445063..445191 - 129 WP_071908338.1 general secretion pathway protein GspI -
DG176_RS16705 445294..446088 - 795 WP_001911581.1 hypothetical protein -
DG176_RS16710 446184..446429 - 246 WP_000643598.1 hypothetical protein Antitoxin
DG176_RS16715 446416..446682 - 267 WP_000589156.1 BrnT family toxin Toxin
DG176_RS16725 446867..447529 - 663 WP_000960654.1 hypothetical protein -
DG176_RS16730 447657..448124 - 468 WP_001289288.1 OsmC family protein -
DG176_RS19835 448336..448374 - 39 WP_082798268.1 hypothetical protein -
DG176_RS19840 448428..448571 - 144 Protein_439 DUF645 family protein -
DG176_RS16750 448946..449224 - 279 WP_000280324.1 DUF3709 domain-containing protein -
DG176_RS16755 449476..449718 - 243 WP_000107461.1 hypothetical protein -
DG176_RS16760 449810..449959 - 150 WP_071908333.1 DUF3265 domain-containing protein -
DG176_RS16765 449932..450183 - 252 WP_001890111.1 TIGR03643 family protein -
DG176_RS16770 450378..450764 - 387 WP_000703163.1 VOC family protein -
DG176_RS16775 450754..450855 - 102 WP_001921603.1 hypothetical protein -
DG176_RS16780 451055..451261 - 207 Protein_446 DUF3709 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T294381 WP_000589156.1 NZ_LT992489:c446682-446416 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT294381 WP_000643598.1 NZ_LT992489:c446429-446184 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References