Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 907114..907661 | Replicon | chromosome |
Accession | NZ_LT992487 | ||
Organism | Vibrio cholerae strain 4295STDY6534216 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | DG247_RS18415 | Protein ID | WP_000229317.1 |
Coordinates | 907114..907416 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | DG247_RS18420 | Protein ID | WP_000861987.1 |
Coordinates | 907404..907661 (-) | Length | 86 a.a. |
Genomic Context
Location: 910735..911007 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 911004..911501 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 902277..902381 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 902438..903037 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 903187..904059 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 904234..904452 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 904516..904953 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 905072..905281 (210 bp)
Type: Others
Protein ID: Protein_767
Type: Others
Protein ID: Protein_767
Location: 905417..905806 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 905963..906880 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 907114..907416 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 907404..907661 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 907863..908396 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 908393..908818 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 908885..909256 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 909397..909684 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 909836..910504 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 911703..911855 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 912177..912632 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG247_RS18375 | 902277..902381 | - | 105 | WP_099607150.1 | acetyltransferase | - |
DG247_RS18380 | 902438..903037 | - | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
DG247_RS18385 | 903187..904059 | - | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
DG247_RS18390 | 904234..904452 | - | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
DG247_RS18395 | 904516..904953 | - | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
DG247_RS18400 | 905072..905281 | - | 210 | Protein_767 | GNAT family N-acetyltransferase | - |
DG247_RS18405 | 905417..905806 | - | 390 | WP_001081302.1 | hypothetical protein | - |
DG247_RS18410 | 905963..906880 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
DG247_RS18415 | 907114..907416 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG247_RS18420 | 907404..907661 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DG247_RS18430 | 907863..908396 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
DG247_RS18435 | 908393..908818 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
DG247_RS18440 | 908885..909256 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
DG247_RS18445 | 909397..909684 | - | 288 | WP_000426470.1 | hypothetical protein | - |
DG247_RS18450 | 909836..910504 | - | 669 | WP_000043871.1 | hypothetical protein | - |
DG247_RS18455 | 910735..911007 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
DG247_RS18460 | 911004..911501 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
DG247_RS18470 | 911703..911855 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
DG247_RS18475 | 912177..912632 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
inside | Integron | catB9 | - | 897901..987709 | 89808 | ||
flank | IS/Tn | - | - | 904516..904953 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T294351 WP_000229317.1 NZ_LT992487:c907416-907114 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |