294351

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 907114..907661 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name relE Uniprot ID Q9KM92
Locus tag DG247_RS18415 Protein ID WP_000229317.1
Coordinates 907114..907416 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag DG247_RS18420 Protein ID WP_000861987.1
Coordinates 907404..907661 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18375 902277..902381 - 105 WP_099607150.1 acetyltransferase -
DG247_RS18380 902438..903037 - 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
DG247_RS18385 903187..904059 - 873 WP_000254716.1 DUF3800 domain-containing protein -
DG247_RS18390 904234..904452 - 219 WP_071908318.1 GNAT family N-acetyltransferase -
DG247_RS18395 904516..904953 - 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
DG247_RS18400 905072..905281 - 210 Protein_767 GNAT family N-acetyltransferase -
DG247_RS18405 905417..905806 - 390 WP_001081302.1 hypothetical protein -
DG247_RS18410 905963..906880 - 918 WP_000186333.1 alpha/beta hydrolase -
DG247_RS18415 907114..907416 - 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG247_RS18420 907404..907661 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG247_RS18430 907863..908396 - 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG247_RS18435 908393..908818 - 426 WP_001882332.1 DUF1778 domain-containing protein -
DG247_RS18440 908885..909256 - 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG247_RS18445 909397..909684 - 288 WP_000426470.1 hypothetical protein -
DG247_RS18450 909836..910504 - 669 WP_000043871.1 hypothetical protein -
DG247_RS18455 910735..911007 + 273 WP_000246253.1 DUF1778 domain-containing protein -
DG247_RS18460 911004..911501 + 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG247_RS18470 911703..911855 - 153 WP_001884520.1 DUF645 family protein -
DG247_RS18475 912177..912632 - 456 WP_001245327.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808
flank IS/Tn - - 904516..904953 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11726.68 Da        Isoelectric Point: 5.1972

>T294351 WP_000229317.1 NZ_LT992487:c907416-907114 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT294351 WP_000861987.1 NZ_LT992487:c907661-907404 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9KM92

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References