Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 394129..394657 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | IR04_RS01990 | Protein ID | WP_000221354.1 |
Coordinates | 394370..394657 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | IR04_RS01985 | Protein ID | WP_001250179.1 |
Coordinates | 394129..394380 (+) | Length | 84 a.a. |
Genomic Context
Location: 389397..389711 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 389848..390282 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 390450..390605 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 391778..392050 (273 bp)
Type: Others
Protein ID: Protein_404
Type: Others
Protein ID: Protein_404
Location: 392221..392913 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 392913..393314 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 393284..393427 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 393502..393915 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 394129..394380 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 394370..394657 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 394785..395240 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 395562..395714 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 396913..397581 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 397733..398020 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 398161..398532 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 398599..399024 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 399021..399554 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 390730..391710 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 395916..396413 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 396410..396682 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS01945 | 389397..389711 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
IR04_RS01950 | 389848..390282 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
IR04_RS20250 | 390450..390605 | + | 156 | WP_000751734.1 | hypothetical protein | - |
IR04_RS01960 | 390730..391710 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
IR04_RS01965 | 391778..392050 | + | 273 | Protein_404 | CatB-related O-acetyltransferase | - |
IR04_RS01970 | 392221..392913 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
IR04_RS01975 | 392913..393314 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
IR04_RS20025 | 393284..393427 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
IR04_RS01980 | 393502..393915 | + | 414 | WP_000049417.1 | VOC family protein | - |
IR04_RS01985 | 394129..394380 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
IR04_RS01990 | 394370..394657 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IR04_RS01995 | 394785..395240 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
IR04_RS02000 | 395562..395714 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
IR04_RS02005 | 395916..396413 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
IR04_RS02010 | 396410..396682 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
IR04_RS02015 | 396913..397581 | + | 669 | WP_000043871.1 | hypothetical protein | - |
IR04_RS02020 | 397733..398020 | + | 288 | WP_000426470.1 | hypothetical protein | - |
IR04_RS02025 | 398161..398532 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
IR04_RS02030 | 398599..399024 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
IR04_RS02035 | 399021..399554 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 | ||
flank | IS/Tn | - | - | 390730..391710 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T48156 WP_000221354.1 NZ_CP009041:394370-394657 [Vibrio cholerae O1 biovar El Tor]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T48156 NZ_CP009041:394370-394657 [Vibrio cholerae O1 biovar El Tor]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT48156 WP_001250179.1 NZ_CP009041:394129-394380 [Vibrio cholerae O1 biovar El Tor]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT48156 NZ_CP009041:394129-394380 [Vibrio cholerae O1 biovar El Tor]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |