Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 231420..231958 | Replicon | chromosome |
Accession | NZ_LT992493 | ||
Organism | Vibrio cholerae strain 4295STDY6534248 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | DG169_RS15615 | Protein ID | WP_000802136.1 |
Coordinates | 231420..231719 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | DG169_RS15620 | Protein ID | WP_001107719.1 |
Coordinates | 231716..231958 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG169_RS19825 | 227166..227294 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
DG169_RS15565 | 227355..227537 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
DG169_RS15570 | 227737..228210 | + | 474 | WP_001161076.1 | GrpB family protein | - |
DG169_RS15575 | 228225..228317 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
DG169_RS15580 | 228359..228985 | + | 627 | WP_000365424.1 | LysE family translocator | - |
DG169_RS15585 | 229108..229806 | + | 699 | WP_001890502.1 | hypothetical protein | - |
DG169_RS15590 | 229816..229926 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
DG169_RS15605 | 230504..230683 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
DG169_RS15610 | 230897..231292 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
DG169_RS15615 | 231420..231719 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG169_RS15620 | 231716..231958 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
DG169_RS15630 | 232187..232765 | + | 579 | WP_000110120.1 | hypothetical protein | - |
DG169_RS15635 | 232787..232879 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
DG169_RS15645 | 233303..233986 | + | 684 | WP_000877436.1 | hypothetical protein | - |
DG169_RS15655 | 234200..234466 | + | 267 | WP_000937852.1 | hypothetical protein | - |
DG169_RS15665 | 234621..235220 | + | 600 | WP_000429495.1 | hypothetical protein | - |
DG169_RS15670 | 235501..236436 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
DG169_RS15675 | 236402..236542 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 197768..293032 | 95264 | |
inside | Integron | catB9 | - | 202848..292656 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T294410 WP_000802136.1 NZ_LT992493:c231719-231420 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|