Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 498313..498811 | Replicon | chromosome |
Accession | NZ_CP013310 | ||
Organism | Vibrio cholerae strain E1162 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | ASZ87_RS16840 | Protein ID | WP_000589156.1 |
Coordinates | 498313..498579 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | ASZ87_RS16845 | Protein ID | WP_000643598.1 |
Coordinates | 498566..498811 (+) | Length | 82 a.a. |
Genomic Context
Location: 493734..493940 (207 bp)
Type: Others
Protein ID: Protein_463
Type: Others
Protein ID: Protein_463
Location: 494140..494241 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 494231..494617 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 494812..495063 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 495036..495185 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 495277..495519 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 495771..496049 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 496424..496567 (144 bp)
Type: Others
Protein ID: Protein_470
Type: Others
Protein ID: Protein_470
Location: 496621..496659 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 496871..497338 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 497466..498128 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 498313..498579 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 498566..498811 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 498907..499701 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 499804..499932 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 499993..500175 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 500391..501395 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 501548..501907 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 502180..502413 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 502681..503187 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 503344..503730 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ87_RS20655 | 493734..493940 | + | 207 | Protein_463 | DUF3709 domain-containing protein | - |
ASZ87_RS20660 | 494140..494241 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ87_RS16795 | 494231..494617 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ87_RS16800 | 494812..495063 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ87_RS16805 | 495036..495185 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ87_RS16810 | 495277..495519 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ87_RS16815 | 495771..496049 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
ASZ87_RS21070 | 496424..496567 | + | 144 | Protein_470 | DUF645 family protein | - |
ASZ87_RS21075 | 496621..496659 | + | 39 | WP_082798268.1 | hypothetical protein | - |
ASZ87_RS16830 | 496871..497338 | + | 468 | WP_001289288.1 | OsmC family protein | - |
ASZ87_RS16835 | 497466..498128 | + | 663 | WP_000960654.1 | hypothetical protein | - |
ASZ87_RS16840 | 498313..498579 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
ASZ87_RS16845 | 498566..498811 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
ASZ87_RS16850 | 498907..499701 | + | 795 | WP_001911581.1 | hypothetical protein | - |
ASZ87_RS21080 | 499804..499932 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
ASZ87_RS16865 | 499993..500175 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
ASZ87_RS16870 | 500391..501395 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
ASZ87_RS16875 | 501548..501907 | + | 360 | WP_001071541.1 | VOC family protein | - |
ASZ87_RS16880 | 502180..502413 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
ASZ87_RS16885 | 502681..503187 | + | 507 | WP_000393074.1 | hypothetical protein | - |
ASZ87_RS16890 | 503344..503730 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 435534..596659 | 161125 | |
inside | Integron | - | - | 440614..596283 | 155669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T58309 WP_000589156.1 NZ_CP013310:498313-498579 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T58309 NZ_CP013310:498313-498579 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT58309 WP_000643598.1 NZ_CP013310:498566-498811 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT58309 NZ_CP013310:498566-498811 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |