Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 429088..429492 | Replicon | chromosome |
Accession | NZ_CP024163 | ||
Organism | Vibrio cholerae strain E7946 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | CSW01_RS16830 | Protein ID | WP_001114075.1 |
Coordinates | 429223..429492 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | CSW01_RS16825 | Protein ID | WP_099607150.1 |
Coordinates | 429088..429192 (+) | Length | 35 a.a. |
Genomic Context
Location: 424589..425506 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 425663..426052 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 426188..426397 (210 bp)
Type: Others
Protein ID: Protein_463
Type: Others
Protein ID: Protein_463
Location: 426516..426953 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 427017..427235 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 427410..428282 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 428432..429031 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 429088..429192 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 429223..429492 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 429486..430007 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 430306..430431 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 430682..431077 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 431969..432484 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 432668..433081 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 431216..431494 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 431491..431775 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSW01_RS16790 | 424589..425506 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
CSW01_RS16795 | 425663..426052 | + | 390 | WP_001081302.1 | hypothetical protein | - |
CSW01_RS16800 | 426188..426397 | + | 210 | Protein_463 | GNAT family N-acetyltransferase | - |
CSW01_RS16805 | 426516..426953 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
CSW01_RS16810 | 427017..427235 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
CSW01_RS16815 | 427410..428282 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
CSW01_RS16820 | 428432..429031 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
CSW01_RS16825 | 429088..429192 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
CSW01_RS16830 | 429223..429492 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
CSW01_RS16835 | 429486..430007 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
CSW01_RS16845 | 430306..430431 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
CSW01_RS16855 | 430682..431077 | + | 396 | WP_001000867.1 | hypothetical protein | - |
CSW01_RS16860 | 431216..431494 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
CSW01_RS16865 | 431491..431775 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
CSW01_RS16870 | 431969..432484 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
CSW01_RS16880 | 432668..433081 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304226..433944 | 129718 | |
inside | Integron | - | - | 309306..433568 | 124262 | ||
flank | IS/Tn | - | - | 426516..426953 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T87031 WP_001114075.1 NZ_CP024163:429223-429492 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T87031 NZ_CP024163:429223-429492 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT87031 WP_099607150.1 NZ_CP024163:429088-429192 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT87031 NZ_CP024163:429088-429192 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |