293809

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 433033..433592 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name relE Uniprot ID Q9K2M8
Locus tag FY484_RS16555 Protein ID WP_000578476.1
Coordinates 433033..433311 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag FY484_RS16560 Protein ID WP_000381183.1
Coordinates 433308..433592 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS16505 428333..428770 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
FY484_RS16510 428834..429052 + 219 WP_071908318.1 GNAT family N-acetyltransferase -
FY484_RS16515 429227..430099 + 873 WP_000254716.1 DUF3800 domain-containing protein -
FY484_RS16520 430249..430848 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
FY484_RS16525 430905..431009 + 105 WP_099607150.1 acetyltransferase -
FY484_RS16530 431040..431309 + 270 WP_001114075.1 DUF4160 domain-containing protein -
FY484_RS16535 431303..431824 + 522 WP_000921691.1 DUF2442 domain-containing protein -
FY484_RS16540 432123..432248 + 126 WP_001905700.1 DUF645 family protein -
FY484_RS16550 432499..432894 + 396 WP_001000867.1 hypothetical protein -
FY484_RS16555 433033..433311 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
FY484_RS16560 433308..433592 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FY484_RS16565 433786..434301 + 516 WP_000343779.1 GNAT family N-acetyltransferase -
FY484_RS16575 434485..434898 + 414 WP_000049420.1 VOC family protein -
FY484_RS16590 435453..436630 + 1178 WP_086010879.1 IS3-like element ISVch4 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639
flank IS/Tn - - 428333..428770 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10819.59 Da        Isoelectric Point: 5.1651

>T293809 WP_000578476.1 NZ_LT906615:c433311-433033 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT293809 WP_000381183.1 NZ_LT906615:c433592-433308 [Vibrio cholerae O1 biovar El Tor str. N16961]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9K2M8

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References