294363

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 972179..972945 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag DG247_RS19135 Protein ID WP_000982260.1
Coordinates 972448..972945 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag DG247_RS19130 Protein ID WP_000246253.1
Coordinates 972179..972451 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS19060 967676..967918 - 243 WP_000107461.1 hypothetical protein -
DG247_RS19065 968010..968159 - 150 WP_071908333.1 DUF3265 domain-containing protein -
DG247_RS19070 968132..968383 - 252 WP_001890111.1 TIGR03643 family protein -
DG247_RS19075 968578..968964 - 387 WP_000703163.1 VOC family protein -
DG247_RS19080 968954..969055 - 102 WP_001921603.1 hypothetical protein -
DG247_RS19085 969255..969461 - 207 Protein_884 DUF3709 domain-containing protein -
DG247_RS19090 969713..969991 - 279 WP_001921601.1 DUF3709 domain-containing protein -
DG247_RS19100 970277..970555 + 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DG247_RS19105 970548..970817 + 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin -
DG247_RS19110 970965..971411 - 447 WP_000006157.1 hypothetical protein -
DG247_RS19120 971607..971645 - 39 WP_106019118.1 hypothetical protein -
DG247_RS19125 971661..971786 - 126 WP_001900195.1 DUF645 family protein -
DG247_RS19130 972179..972451 + 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
DG247_RS19135 972448..972945 + 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
DG247_RS19140 973095..973610 - 516 WP_001201509.1 lipocalin family protein -
DG247_RS19145 973747..974283 - 537 WP_000469482.1 GNAT family N-acetyltransferase -
DG247_RS19160 974541..974822 - 282 WP_001894429.1 DUF1289 domain-containing protein -
DG247_RS19165 974771..974884 - 114 WP_001900214.1 hypothetical protein -
DG247_RS19170 974941..975327 - 387 WP_001015867.1 NUDIX hydrolase -
DG247_RS19175 975571..975813 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG247_RS19180 975832..976149 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG247_RS19190 976303..976641 - 339 WP_000713853.1 hypothetical protein -
DG247_RS19195 976799..977503 - 705 WP_000087610.1 HNH endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T294363 WP_000982260.1 NZ_LT992487:972448-972945 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT294363 WP_000246253.1 NZ_LT992487:972179-972451 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References