Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 972179..972945 | Replicon | chromosome |
Accession | NZ_LT992487 | ||
Organism | Vibrio cholerae strain 4295STDY6534216 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | DG247_RS19135 | Protein ID | WP_000982260.1 |
Coordinates | 972448..972945 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | DG247_RS19130 | Protein ID | WP_000246253.1 |
Coordinates | 972179..972451 (+) | Length | 91 a.a. |
Genomic Context
Location: 970277..970555 (279 bp)
Type: Others
Protein ID: WP_001258569.1
Type: Others
Protein ID: WP_001258569.1
Location: 970548..970817 (270 bp)
Type: Others
Protein ID: WP_000277238.1
Type: Others
Protein ID: WP_000277238.1
Location: 972179..972451 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Location: 972448..972945 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 975571..975813 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 975832..976149 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 967676..967918 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 968010..968159 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 968132..968383 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 968578..968964 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 968954..969055 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 969255..969461 (207 bp)
Type: Others
Protein ID: Protein_884
Type: Others
Protein ID: Protein_884
Location: 969713..969991 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 970965..971411 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 971607..971645 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 971661..971786 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 973095..973610 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 973747..974283 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 974541..974822 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 974771..974884 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 974941..975327 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 976303..976641 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 976799..977503 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG247_RS19060 | 967676..967918 | - | 243 | WP_000107461.1 | hypothetical protein | - |
DG247_RS19065 | 968010..968159 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
DG247_RS19070 | 968132..968383 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
DG247_RS19075 | 968578..968964 | - | 387 | WP_000703163.1 | VOC family protein | - |
DG247_RS19080 | 968954..969055 | - | 102 | WP_001921603.1 | hypothetical protein | - |
DG247_RS19085 | 969255..969461 | - | 207 | Protein_884 | DUF3709 domain-containing protein | - |
DG247_RS19090 | 969713..969991 | - | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
DG247_RS19100 | 970277..970555 | + | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
DG247_RS19105 | 970548..970817 | + | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | - |
DG247_RS19110 | 970965..971411 | - | 447 | WP_000006157.1 | hypothetical protein | - |
DG247_RS19120 | 971607..971645 | - | 39 | WP_106019118.1 | hypothetical protein | - |
DG247_RS19125 | 971661..971786 | - | 126 | WP_001900195.1 | DUF645 family protein | - |
DG247_RS19130 | 972179..972451 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
DG247_RS19135 | 972448..972945 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
DG247_RS19140 | 973095..973610 | - | 516 | WP_001201509.1 | lipocalin family protein | - |
DG247_RS19145 | 973747..974283 | - | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
DG247_RS19160 | 974541..974822 | - | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
DG247_RS19165 | 974771..974884 | - | 114 | WP_001900214.1 | hypothetical protein | - |
DG247_RS19170 | 974941..975327 | - | 387 | WP_001015867.1 | NUDIX hydrolase | - |
DG247_RS19175 | 975571..975813 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DG247_RS19180 | 975832..976149 | + | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG247_RS19190 | 976303..976641 | - | 339 | WP_000713853.1 | hypothetical protein | - |
DG247_RS19195 | 976799..977503 | - | 705 | WP_000087610.1 | HNH endonuclease | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
inside | Integron | catB9 | - | 897901..987709 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T294363 WP_000982260.1 NZ_LT992487:972448-972945 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |