293803

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 419998..420526 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag FY484_RS16420 Protein ID WP_000221354.1
Coordinates 420239..420526 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag FY484_RS16415 Protein ID WP_001250179.1
Coordinates 419998..420249 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS16375 415266..415580 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
FY484_RS16380 415717..416151 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
FY484_RS19565 416319..416474 + 156 WP_000751734.1 hypothetical protein -
FY484_RS16385 416599..417579 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
FY484_RS16390 417647..417953 + 307 Protein_446 CatB-related O-acetyltransferase -
FY484_RS16395 418090..418782 + 693 WP_001047169.1 GNAT family N-acetyltransferase -
FY484_RS16400 418782..419183 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
FY484_RS16405 419153..419296 + 144 WP_071908341.1 DUF3265 domain-containing protein -
FY484_RS16410 419371..419784 + 414 WP_000049417.1 VOC family protein -
FY484_RS16415 419998..420249 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FY484_RS16420 420239..420526 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FY484_RS16425 420654..421109 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
FY484_RS16430 421431..421583 + 153 WP_001884520.1 DUF645 family protein -
FY484_RS16440 421785..422282 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
FY484_RS16445 422279..422551 - 273 WP_000246253.1 DUF1778 domain-containing protein -
FY484_RS16450 422782..423450 + 669 WP_000043871.1 hypothetical protein -
FY484_RS16455 423602..423889 + 288 WP_000426470.1 hypothetical protein -
FY484_RS16460 424030..424401 + 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
FY484_RS19570 424468..424893 + 426 WP_001882332.1 DUF1778 domain-containing protein -
FY484_RS16470 424890..425423 + 534 WP_000118351.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639
flank IS/Tn - - 416599..417579 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-71)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T293803 WP_000221354.1 NZ_LT906615:420239-420526 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT293803 WP_001250179.1 NZ_LT906615:419998-420249 [Vibrio cholerae O1 biovar El Tor str. N16961]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6

Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References