Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 426039..426586 | Replicon | chromosome |
Accession | NZ_CP072848 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | J9265_RS16080 | Protein ID | WP_000229317.1 |
Coordinates | 426284..426586 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | J9265_RS16075 | Protein ID | WP_000861987.1 |
Coordinates | 426039..426296 (+) | Length | 86 a.a. |
Genomic Context
Location: 421068..421523 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421580..421702 (123 bp)
Type: Others
Protein ID: Protein_480
Type: Others
Protein ID: Protein_480
Location: 421873..421997 (125 bp)
Type: Others
Protein ID: Protein_481
Type: Others
Protein ID: Protein_481
Location: 422114..422182 (69 bp)
Type: Others
Protein ID: Protein_482
Type: Others
Protein ID: Protein_482
Location: 423117..423179 (63 bp)
Type: Others
Protein ID: Protein_485
Type: Others
Protein ID: Protein_485
Location: 423196..423864 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 424016..424303 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 424444..424815 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 425038..425307 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 425304..425837 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 425847..425957 (111 bp)
Type: Others
Protein ID: WP_086010065.1
Type: Others
Protein ID: WP_086010065.1
Location: 426039..426296 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 426284..426586 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 426820..427737 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 427894..428283 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 428419..428628 (210 bp)
Type: Others
Protein ID: Protein_496
Type: Others
Protein ID: Protein_496
Location: 428747..429184 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 429245..429466 (222 bp)
Type: Others
Protein ID: Protein_498
Type: Others
Protein ID: Protein_498
Location: 429641..430513 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 430663..431262 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 431319..431387 (69 bp)
Type: Others
Protein ID: Protein_501
Type: Others
Protein ID: Protein_501
Location: 422199..422696 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 422693..422965 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J9265_RS16030 (J9265_16030) | 421068..421523 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
J9265_RS19175 | 421580..421702 | + | 123 | Protein_480 | acetyltransferase | - |
J9265_RS16035 (J9265_16035) | 421873..421997 | + | 125 | Protein_481 | DUF645 family protein | - |
J9265_RS19180 | 422114..422182 | + | 69 | Protein_482 | acetyltransferase | - |
J9265_RS16040 (J9265_16040) | 422199..422696 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
J9265_RS16045 (J9265_16045) | 422693..422965 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
J9265_RS19185 | 423117..423179 | + | 63 | Protein_485 | acetyltransferase | - |
J9265_RS16050 (J9265_16050) | 423196..423864 | + | 669 | WP_000043871.1 | hypothetical protein | - |
J9265_RS16055 (J9265_16055) | 424016..424303 | + | 288 | WP_000426470.1 | hypothetical protein | - |
J9265_RS16060 (J9265_16060) | 424444..424815 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
J9265_RS19190 | 425038..425307 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
J9265_RS16070 (J9265_16070) | 425304..425837 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
J9265_RS19195 | 425847..425957 | + | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
J9265_RS16075 (J9265_16075) | 426039..426296 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
J9265_RS16080 (J9265_16080) | 426284..426586 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
J9265_RS16085 (J9265_16085) | 426820..427737 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
J9265_RS16090 (J9265_16090) | 427894..428283 | + | 390 | WP_001081302.1 | hypothetical protein | - |
J9265_RS16095 (J9265_16095) | 428419..428628 | + | 210 | Protein_496 | GNAT family N-acetyltransferase | - |
J9265_RS16100 (J9265_16100) | 428747..429184 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
J9265_RS16105 (J9265_16105) | 429245..429466 | + | 222 | Protein_498 | GNAT family N-acetyltransferase | - |
J9265_RS16110 (J9265_16110) | 429641..430513 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
J9265_RS16115 (J9265_16115) | 430663..431262 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
J9265_RS16120 (J9265_16120) | 431319..431387 | + | 69 | Protein_501 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306914..436175 | 129261 | |
inside | Integron | - | - | 311994..435799 | 123805 | ||
flank | IS/Tn | - | - | 428747..429184 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T198992 WP_000229317.1 NZ_CP072848:426284-426586 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T198992 NZ_CP097082:1896528-1896630 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT198992 WP_000861987.1 NZ_CP072848:426039-426296 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT198992 NZ_CP097082:c1896637-1896492 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |