Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 413164..413797 | Replicon | chromosome |
Accession | NZ_CP024868 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | VCA1552_RS16730 | Protein ID | WP_000843587.1 |
Coordinates | 413164..413496 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | VCA1552_RS16735 | Protein ID | WP_000071008.1 |
Coordinates | 413483..413797 (+) | Length | 105 a.a. |
Genomic Context
Location: 408605..408808 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 409089..409262 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 409622..409891 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 410209..410380 (172 bp)
Type: Others
Protein ID: Protein_430
Type: Others
Protein ID: Protein_430
Location: 410589..410975 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 411177..411419 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 411590..411967 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 412024..412138 (115 bp)
Type: Others
Protein ID: Protein_434
Type: Others
Protein ID: Protein_434
Location: 412087..412368 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 412534..412647 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 412596..412823 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 413164..413496 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 413483..413797 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 413934..414368 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 414536..414691 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 415864..416136 (273 bp)
Type: Others
Protein ID: Protein_443
Type: Others
Protein ID: Protein_443
Location: 416307..416999 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 416999..417400 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 417370..417513 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 417588..418001 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 418215..418466 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 418456..418743 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 414816..415796 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VCA1552_RS20030 | 408605..408808 | + | 204 | WP_001911745.1 | hypothetical protein | - |
VCA1552_RS16660 | 409089..409262 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
VCA1552_RS16665 | 409622..409891 | + | 270 | WP_001198131.1 | hypothetical protein | - |
VCA1552_RS16675 | 410209..410380 | + | 172 | Protein_430 | DUF645 family protein | - |
VCA1552_RS16680 | 410589..410975 | + | 387 | WP_000703163.1 | VOC family protein | - |
VCA1552_RS16685 | 411177..411419 | + | 243 | WP_000107461.1 | hypothetical protein | - |
VCA1552_RS16690 | 411590..411967 | + | 378 | WP_000411109.1 | hypothetical protein | - |
VCA1552_RS20035 | 412024..412138 | + | 115 | Protein_434 | acetyltransferase | - |
VCA1552_RS16695 | 412087..412368 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
VCA1552_RS16710 | 412534..412647 | + | 114 | WP_001889158.1 | hypothetical protein | - |
VCA1552_RS16715 | 412596..412823 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
VCA1552_RS16730 | 413164..413496 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
VCA1552_RS16735 | 413483..413797 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
VCA1552_RS16740 | 413934..414368 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
VCA1552_RS19910 | 414536..414691 | + | 156 | WP_000751734.1 | hypothetical protein | - |
VCA1552_RS16745 | 414816..415796 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
VCA1552_RS16750 | 415864..416136 | + | 273 | Protein_443 | CatB-related O-acetyltransferase | - |
VCA1552_RS16755 | 416307..416999 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
VCA1552_RS16760 | 416999..417400 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
VCA1552_RS16765 | 417370..417513 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
VCA1552_RS16770 | 417588..418001 | + | 414 | WP_000049417.1 | VOC family protein | - |
VCA1552_RS16775 | 418215..418466 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
VCA1552_RS16780 | 418456..418743 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 309797..433602 | 123805 | ||
flank | IS/Tn | - | - | 414816..415796 | 980 | ||
- | inside | Genomic island | catB9 | - | 304717..433978 | 129261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T88996 WP_000843587.1 NZ_CP024868:413164-413496 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T88996 NZ_CP024868:413164-413496 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT88996 WP_000071008.1 NZ_CP024868:413483-413797 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT88996 NZ_CP024868:413483-413797 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA