Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 98261..98789 | Replicon | chromosome |
Accession | NZ_AP024548 | ||
Organism | Vibrio cholerae strain BCH-01536 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | K6J77_RS14655 | Protein ID | WP_000221354.1 |
Coordinates | 98502..98789 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | K6J77_RS14650 | Protein ID | WP_001250179.1 |
Coordinates | 98261..98512 (+) | Length | 84 a.a. |
Genomic Context
Location: 93529..93843 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 93980..94414 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 94582..94737 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 95910..96216 (307 bp)
Type: Others
Protein ID: Protein_179
Type: Others
Protein ID: Protein_179
Location: 96353..96751 (399 bp)
Type: Others
Protein ID: Protein_180
Type: Others
Protein ID: Protein_180
Location: 96875..97045 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 97045..97446 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 97449..97559 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 97634..98047 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 98261..98512 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 98502..98789 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 98917..99372 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 99429..99551 (123 bp)
Type: Others
Protein ID: Protein_188
Type: Others
Protein ID: Protein_188
Location: 99722..99846 (125 bp)
Type: Others
Protein ID: Protein_189
Type: Others
Protein ID: Protein_189
Location: 99963..100031 (69 bp)
Type: Others
Protein ID: Protein_190
Type: Others
Protein ID: Protein_190
Location: 100966..101028 (63 bp)
Type: Others
Protein ID: Protein_193
Type: Others
Protein ID: Protein_193
Location: 101045..101713 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 101865..102152 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 102293..102664 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 102887..103156 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 103153..103686 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 94862..95842 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 100048..100545 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 100542..100814 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J77_RS14610 | 93529..93843 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
K6J77_RS14615 | 93980..94414 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
K6J77_RS14620 | 94582..94737 | + | 156 | WP_000751734.1 | hypothetical protein | - |
K6J77_RS14625 | 94862..95842 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
K6J77_RS14630 | 95910..96216 | + | 307 | Protein_179 | CatB-related O-acetyltransferase | - |
K6J77_RS19080 | 96353..96751 | + | 399 | Protein_180 | GNAT family N-acetyltransferase | - |
K6J77_RS19085 | 96875..97045 | + | 171 | WP_001080654.1 | hypothetical protein | - |
K6J77_RS14640 | 97045..97446 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
K6J77_RS19090 | 97449..97559 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
K6J77_RS14645 | 97634..98047 | + | 414 | WP_000049417.1 | VOC family protein | - |
K6J77_RS14650 | 98261..98512 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
K6J77_RS14655 | 98502..98789 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J77_RS14660 | 98917..99372 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
K6J77_RS19095 | 99429..99551 | + | 123 | Protein_188 | acetyltransferase | - |
K6J77_RS14665 | 99722..99846 | + | 125 | Protein_189 | DUF645 family protein | - |
K6J77_RS19100 | 99963..100031 | + | 69 | Protein_190 | acetyltransferase | - |
K6J77_RS14670 | 100048..100545 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
K6J77_RS14675 | 100542..100814 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K6J77_RS19105 | 100966..101028 | + | 63 | Protein_193 | acetyltransferase | - |
K6J77_RS14680 | 101045..101713 | + | 669 | WP_000043871.1 | hypothetical protein | - |
K6J77_RS14685 | 101865..102152 | + | 288 | WP_000426470.1 | hypothetical protein | - |
K6J77_RS14690 | 102293..102664 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
K6J77_RS19110 | 102887..103156 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
K6J77_RS14700 | 103153..103686 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 11978..113648 | 101670 | ||
flank | IS/Tn | - | - | 94862..95842 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T38627 WP_000221354.1 NZ_AP024548:98502-98789 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T38627 NZ_AP024548:98502-98789 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT38627 WP_001250179.1 NZ_AP024548:98261-98512 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT38627 NZ_AP024548:98261-98512 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |