Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 58949..59447 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | C4E16_RS14530 | Protein ID | WP_000589156.1 |
Coordinates | 58949..59215 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | C4E16_RS14535 | Protein ID | WP_000643598.1 |
Coordinates | 59202..59447 (+) | Length | 82 a.a. |
Genomic Context
Location: 54370..54576 (207 bp)
Type: Others
Protein ID: Protein_68
Type: Others
Protein ID: Protein_68
Location: 54776..54877 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 54867..55253 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 55448..55699 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 55672..55821 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 55913..56155 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 56407..56685 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 57060..57203 (144 bp)
Type: Others
Protein ID: Protein_75
Type: Others
Protein ID: Protein_75
Location: 57257..57295 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 57507..57974 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 58102..58764 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 58949..59215 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 59202..59447 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 59543..60337 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 60440..60568 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 60629..60811 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 61027..62031 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 62184..62543 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 62816..63049 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 63317..63823 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 63980..64366 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS19420 | 54370..54576 | + | 207 | Protein_68 | DUF3709 domain-containing protein | - |
C4E16_RS14470 | 54776..54877 | + | 102 | WP_001921603.1 | hypothetical protein | - |
C4E16_RS14475 | 54867..55253 | + | 387 | WP_000703163.1 | VOC family protein | - |
C4E16_RS14480 | 55448..55699 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
C4E16_RS14485 | 55672..55821 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
C4E16_RS14490 | 55913..56155 | + | 243 | WP_000107461.1 | hypothetical protein | - |
C4E16_RS14495 | 56407..56685 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
C4E16_RS19550 | 57060..57203 | + | 144 | Protein_75 | DUF645 family protein | - |
C4E16_RS19555 | 57257..57295 | + | 39 | WP_082798268.1 | hypothetical protein | - |
C4E16_RS14515 | 57507..57974 | + | 468 | WP_001289288.1 | OsmC family protein | - |
C4E16_RS14520 | 58102..58764 | + | 663 | WP_000960654.1 | hypothetical protein | - |
C4E16_RS14530 | 58949..59215 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
C4E16_RS14535 | 59202..59447 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
C4E16_RS14540 | 59543..60337 | + | 795 | WP_001911581.1 | hypothetical protein | - |
C4E16_RS19560 | 60440..60568 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
C4E16_RS14555 | 60629..60811 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
C4E16_RS14560 | 61027..62031 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
C4E16_RS14565 | 62184..62543 | + | 360 | WP_001071541.1 | VOC family protein | - |
C4E16_RS14570 | 62816..63049 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
C4E16_RS14575 | 63317..63823 | + | 507 | WP_000393074.1 | hypothetical protein | - |
C4E16_RS14580 | 63980..64366 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T95378 WP_000589156.1 NZ_CP026648:58949-59215 [Vibrio cholerae O1 biovar El Tor]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T95378 NZ_CP026648:58949-59215 [Vibrio cholerae O1 biovar El Tor]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT95378 WP_000643598.1 NZ_CP026648:59202-59447 [Vibrio cholerae O1 biovar El Tor]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT95378 NZ_CP026648:59202-59447 [Vibrio cholerae O1 biovar El Tor]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |