294413

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 256560..257088 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag DG169_RS15870 Protein ID WP_000221352.1
Coordinates 256560..256850 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag DG169_RS15875 Protein ID WP_000213183.1
Coordinates 256840..257088 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS19835 251830..251940 + 111 WP_134814058.1 DUF3265 domain-containing protein -
DG169_RS19840 252117..252242 + 126 WP_001944767.1 DUF645 family protein -
DG169_RS19845 252258..252296 + 39 WP_106019119.1 hypothetical protein -
DG169_RS15840 252509..253513 + 1005 WP_000964925.1 LD-carboxypeptidase -
DG169_RS15845 253666..254112 + 447 WP_000128977.1 hypothetical protein -
DG169_RS15850 254232..255161 + 930 WP_000335802.1 hypothetical protein -
DG169_RS15855 255158..255268 + 111 WP_071917832.1 DUF3265 domain-containing protein -
DG169_RS15860 255296..255772 + 477 WP_001047180.1 GNAT family N-acetyltransferase -
DG169_RS15865 255909..256424 + 516 WP_001201528.1 lipocalin family protein -
DG169_RS15870 256560..256850 - 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG169_RS15875 256840..257088 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG169_RS15890 257659..258312 + 654 WP_000036957.1 site-specific DNA-methyltransferase -
DG169_RS15895 258584..259009 + 426 WP_000415748.1 hypothetical protein -
DG169_RS15900 259217..259612 + 396 WP_000649527.1 DUF3465 domain-containing protein -
DG169_RS15905 259763..260293 + 531 WP_000415563.1 hypothetical protein -
DG169_RS15910 260431..260931 + 501 WP_000789723.1 hypothetical protein -
DG169_RS15920 261087..261489 + 403 Protein_281 hypothetical protein -
DG169_RS15925 261589..262053 - 465 WP_000140244.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T294413 WP_000221352.1 NZ_LT992493:c256850-256560 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT294413 WP_000213183.1 NZ_LT992493:c257088-256840 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References