Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 341897..342456 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9K2M8 |
Locus tag | IR04_RS01600 | Protein ID | WP_000578476.1 |
Coordinates | 341897..342175 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | IR04_RS01605 | Protein ID | WP_000381183.1 |
Coordinates | 342172..342456 (-) | Length | 95 a.a. |
Genomic Context
Location: 336975..337481 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 337638..338024 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 338281..338484 (204 bp)
Type: Others
Protein ID: WP_001911580.1
Type: Others
Protein ID: WP_001911580.1
Location: 338679..338930 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 338903..339052 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 339199..339624 (426 bp)
Type: Others
Protein ID: WP_000415750.1
Type: Others
Protein ID: WP_000415750.1
Location: 339830..340453 (624 bp)
Type: Others
Protein ID: WP_000247070.1
Type: Others
Protein ID: WP_000247070.1
Location: 340666..341145 (480 bp)
Type: Others
Protein ID: WP_000009888.1
Type: Others
Protein ID: WP_000009888.1
Location: 341333..341746 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 342651..343166 (516 bp)
Type: Others
Protein ID: WP_001201520.1
Type: Others
Protein ID: WP_001201520.1
Location: 343231..343827 (597 bp)
Type: Others
Protein ID: WP_000255434.1
Type: Others
Protein ID: WP_000255434.1
Location: 344219..344401 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 344601..345074 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 345089..345181 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 345223..345849 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 345972..346670 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 346680..346790 (111 bp)
Type: Others
Protein ID: WP_079857360.1
Type: Others
Protein ID: WP_079857360.1
Location: 341897..342175 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1
Type: Toxin
Protein ID: WP_000578476.1
Location: 342172..342456 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1
Type: Antitoxin
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS01560 | 336975..337481 | + | 507 | WP_000393074.1 | hypothetical protein | - |
IR04_RS01565 | 337638..338024 | + | 387 | WP_000703163.1 | VOC family protein | - |
IR04_RS01570 | 338281..338484 | + | 204 | WP_001911580.1 | hypothetical protein | - |
IR04_RS01575 | 338679..338930 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
IR04_RS19225 | 338903..339052 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
IR04_RS01580 | 339199..339624 | + | 426 | WP_000415750.1 | hypothetical protein | - |
IR04_RS01585 | 339830..340453 | + | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
IR04_RS01590 | 340666..341145 | + | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
IR04_RS01595 | 341333..341746 | + | 414 | WP_000049420.1 | VOC family protein | - |
IR04_RS01600 | 341897..342175 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
IR04_RS01605 | 342172..342456 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
IR04_RS01610 | 342651..343166 | + | 516 | WP_001201520.1 | lipocalin family protein | - |
IR04_RS01615 | 343231..343827 | + | 597 | WP_000255434.1 | hypothetical protein | - |
IR04_RS01620 | 344219..344401 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
IR04_RS01625 | 344601..345074 | + | 474 | WP_001161076.1 | GrpB family protein | - |
IR04_RS19240 | 345089..345181 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
IR04_RS01630 | 345223..345849 | + | 627 | WP_000365424.1 | LysE family translocator | - |
IR04_RS01635 | 345972..346670 | + | 699 | WP_001890502.1 | hypothetical protein | - |
IR04_RS19245 | 346680..346790 | + | 111 | WP_079857360.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T48149 WP_000578476.1 NZ_CP009041:c342175-341897 [Vibrio cholerae O1 biovar El Tor]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
>T48149 NZ_CP009041:c342175-341897 [Vibrio cholerae O1 biovar El Tor]
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT48149 WP_000381183.1 NZ_CP009041:c342456-342172 [Vibrio cholerae O1 biovar El Tor]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT48149 NZ_CP009041:c342456-342172 [Vibrio cholerae O1 biovar El Tor]
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9K2M8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067BL33 |