294384

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 457371..457949 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name parE Uniprot ID O68848
Locus tag DG176_RS16875 Protein ID WP_001180243.1
Coordinates 457632..457949 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q7DCR7
Locus tag DG176_RS16870 Protein ID WP_000557292.1
Coordinates 457371..457613 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16805 452765..453211 - 447 WP_000006157.1 hypothetical protein -
DG176_RS16815 453407..453445 - 39 WP_106019118.1 hypothetical protein -
DG176_RS16820 453461..453586 - 126 WP_001900195.1 DUF645 family protein -
DG176_RS16825 453979..454251 + 273 WP_000246253.1 DUF1778 domain-containing protein -
DG176_RS16830 454248..454745 + 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG176_RS16835 454895..455410 - 516 WP_001201509.1 lipocalin family protein -
DG176_RS16840 455547..456083 - 537 WP_000469482.1 GNAT family N-acetyltransferase -
DG176_RS16855 456341..456622 - 282 WP_001894429.1 DUF1289 domain-containing protein -
DG176_RS16860 456571..456684 - 114 WP_001900214.1 hypothetical protein -
DG176_RS16865 456741..457127 - 387 WP_001015867.1 NUDIX hydrolase -
DG176_RS16870 457371..457613 + 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG176_RS16875 457632..457949 + 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG176_RS16885 458103..458441 - 339 WP_000713853.1 hypothetical protein -
DG176_RS16890 458599..459303 - 705 WP_000087610.1 HNH endonuclease -
DG176_RS16895 459465..460673 - 1209 WP_000272282.1 deoxyguanosinetriphosphate triphosphohydrolase family protein -
DG176_RS16900 460835..461512 - 678 WP_000254617.1 HNH endonuclease -
DG176_RS16910 461707..461889 - 183 WP_000923153.1 DUF645 family protein -
DG176_RS16915 462243..462425 - 183 WP_000923340.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12158.97 Da        Isoelectric Point: 9.7495

>T294384 WP_001180243.1 NZ_LT992489:457632-457949 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8961.25 Da        Isoelectric Point: 5.6630

>AT294384 WP_000557292.1 NZ_LT992489:457371-457613 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K9UJR8

Antitoxin

Source ID Structure
AlphaFold DB Q7DCR7

References