Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | DhiAT/- |
Location | 497743..498527 | Replicon | chromosome |
Accession | NZ_CP064351 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | IT766_RS16375 | Protein ID | WP_001114075.1 |
Coordinates | 497743..498012 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | dhiA | Uniprot ID | Q9KM84 |
Locus tag | IT766_RS16380 | Protein ID | WP_000921691.1 |
Coordinates | 498006..498527 (+) | Length | 174 a.a. |
Genomic Context
Location: 493109..494026 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 494183..494572 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 494708..494917 (210 bp)
Type: Others
Protein ID: Protein_519
Type: Others
Protein ID: Protein_519
Location: 495036..495473 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 495537..495755 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 495930..496802 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 496952..497551 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 497608..497712 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 497743..498012 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 498006..498527 (522 bp)
Type: Antitoxin
Protein ID: WP_000921691.1
Type: Antitoxin
Protein ID: WP_000921691.1
Location: 498826..498951 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 499202..499597 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 500489..501004 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 501188..501601 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 502156..503333 (1178 bp)
Type: Others
Protein ID: WP_086010879.1
Type: Others
Protein ID: WP_086010879.1
Location: 499736..500014 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 500011..500295 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IT766_RS16335 | 493109..494026 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
IT766_RS16340 | 494183..494572 | + | 390 | WP_001081302.1 | hypothetical protein | - |
IT766_RS16345 | 494708..494917 | + | 210 | Protein_519 | GNAT family N-acetyltransferase | - |
IT766_RS16350 | 495036..495473 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
IT766_RS16355 | 495537..495755 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
IT766_RS16360 | 495930..496802 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
IT766_RS16365 | 496952..497551 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
IT766_RS16370 | 497608..497712 | + | 105 | WP_099607150.1 | acetyltransferase | - |
IT766_RS16375 | 497743..498012 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
IT766_RS16380 | 498006..498527 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
IT766_RS16385 | 498826..498951 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
IT766_RS16390 | 499202..499597 | + | 396 | WP_001000867.1 | hypothetical protein | - |
IT766_RS16395 | 499736..500014 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
IT766_RS16400 | 500011..500295 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
IT766_RS16405 | 500489..501004 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
IT766_RS16410 | 501188..501601 | + | 414 | WP_000049420.1 | VOC family protein | - |
IT766_RS16415 | 502156..503333 | + | 1178 | WP_086010879.1 | IS3-like element ISVch4 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 373204..502464 | 129260 | |
inside | Integron | - | - | 378284..502088 | 123804 | ||
flank | IS/Tn | - | - | 495036..495473 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T180881 WP_001114075.1 NZ_CP064351:497743-498012 [Vibrio cholerae C6706]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T180881 NZ_CP085767:c4663914-4663811 [Enterobacter hormaechei]
GGCAGGGCGATTGAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAGGGCGATTGAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT180881 WP_000921691.1 NZ_CP064351:498006-498527 [Vibrio cholerae C6706]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
>AT180881 NZ_CP085767:4663806-4664007 [Enterobacter hormaechei]
CAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTT
GGCATTAATGCAGGCTCAATCGCCCTGCCCTTTAAGAATAGATGACGACGTCAGGTTTTCCAGTCCACAGCAAAAGTGGT
CTGAAAAAAAGCGTCAGAACATCACTAAATGTGAAAAACCGC
CAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTT
GGCATTAATGCAGGCTCAATCGCCCTGCCCTTTAAGAATAGATGACGACGTCAGGTTTTCCAGTCCACAGCAAAAGTGGT
CTGAAAAAAAGCGTCAGAACATCACTAAATGTGAAAAACCGC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM84 |